Tested Applications
| Positive WB detected in | K-562 cells, HEK-293 cells, human brain tissue, NIH/3T3 cells, U-937 cells |
| Positive IP detected in | K-562 cells |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16031-1-AP targets RNF2 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8900 Product name: Recombinant human RNF2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-336 aa of BC012583 Sequence: MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK Predict reactive species |
| Full Name | ring finger protein 2 |
| Calculated Molecular Weight | 336 aa, 38 kDa |
| Observed Molecular Weight | 38 kDa |
| GenBank Accession Number | BC012583 |
| Gene Symbol | RNF2 |
| Gene ID (NCBI) | 6045 |
| RRID | AB_2180459 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99496 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RNF2 (also known as ding, Ring1B or Ring2) is a member of the Ring finger protein family, which functions as E3 ubiquitin ligase for monoubiquitination of histone H2A at lysine 119 (H2AK119ub). Many studies have demonstrated that overexpressed RNF2 was involved in the pathological progression of multiple cancers and has an impact on their clinical features. For instance, the upregulated expression level of RNF2 is positively correlated with the occurrence and progression of hepatocellular carcinoma, melanoma, prostate cancer, breast cancer, pancreatic cancer, gastric cancer, and bladder urothelial carcinoma, as well as with the radioresistance of lung cancer and chemoresistance of ovarian cancer (PMID: 33400276). The molecular weight of RNF2 is 38 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RNF2 antibody 16031-1-AP | Download protocol |
| IP protocol for RNF2 antibody 16031-1-AP | Download protocol |
| WB protocol for RNF2 antibody 16031-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-RNF2 (Cat# 16031-1-AP) has 24 citations published in journals including Cancer Cell, Nature Communications, Cell Reports, Developmental Cell, Advanced Science, Journal of Experimental & Clinical Cancer Research, Cell Death & Differentiation, and FEBS Journal. Research fields span epigenetics (PRC1/Polycomb regulation), ubiquitination-mediated degradation, cancer biology (prostate, liver, cervical, colon, lung, bone), lipid metabolism, cardiac remodeling, DNA damage response, ferroptosis, viral pathogenesis, neurodevelopment, and inflammatory disease.
| Species | Application | Title |
|---|---|---|
Cancer Cell Coordinated regulation of polycomb group complexes through microRNAs in cancer.
| ||
Cancer Cell The Polycomb Repressor Complex 1 Drives Double-Negative Prostate Cancer Metastasis by Coordinating Stemness and Immune Suppression.
| ||
J Exp Clin Cancer Res UBE2T-regulated H2AX monoubiquitination induces hepatocellular carcinoma radioresistance by facilitating CHK1 activation. | ||
Adv Sci (Weinh) Targeted Degradation of PRC1 Components, BMI1 and RING1B, via a Novel Protein Complex Degrader Strategy | ||
Cell Death Differ CRL4B complex-mediated H2AK119 monoubiquitination restrains Th1 and Th2 cell differentiation | ||
Int J Biol Sci RNF2 Modulates Lipid Metabolism and Inflammation in Alcohol-associated Liver Disease by Interacting with USP7
|
