Featured Product
KD/KO Validated

GGCX Polyclonal antibody

GGCX Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 16209-1-AP

Publications (13)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

gamma glutamyl carboxylase, GC, GGCX, VKCFD1

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHC

WB analysis of MCF-7 using 16209-1-AP
MCF7 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HepG2 using 16209-1-AP
HepG2 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of MCF-7 using 16209-1-AP
MCF7 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of PC-3 using 16209-1-AP
PC-3 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse liver using 16209-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HEK-293 using 16209-1-AP
HEK-293 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of PC-3 using 16209-1-AP
PC-3 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse liver using 16209-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of MCF-7 using 16209-1-AP
MCF7 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of L02 using 16209-1-AP
L02 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HepG2 using 16209-1-AP
HepG2 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of mouse liver using 16209-1-AP
IP result of anti-GGCX (IP:16209-1-AP, 4ug; Detection:16209-1-AP 1:2000) with mouse liver tissue lysate 4000ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 16209-1-AP
Immunohistochemical analysis of paraffin-embedded human liver using 16209-1-AP (GGCX antibody) at dilution of 1:100 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 16209-1-AP
Immunohistochemical analysis of paraffin-embedded human liver using 16209-1-AP (GGCX antibody) at dilution of 1:100 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 16209-1-AP
Immunohistochemical analysis of paraffin-embedded human liver using 16209-1-AP (GGCX antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 16209-1-AP
Immunohistochemical analysis of paraffin-embedded human liver using 16209-1-AP (GGCX antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human brain using 16209-1-AP
Immunohistochemical analysis of paraffin-embedded human brain using 16209-1-AP (GGCX antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human brain using 16209-1-AP
Immunohistochemical analysis of paraffin-embedded human brain using 16209-1-AP (GGCX antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GGCX in ?

Overview

Tested Applications
Product Information
Publications (13)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	MCF7 cells, HEK-293 cells, HepG2 cells, L02 cells, MCF-7 cells, mouse liver tissue, PC-3 cells
Positive IP detected in	mouse liver tissue
Positive IHC detected in	human liver tissue, human brain tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:4000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16209-1-AP targets GGCX in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, pig
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag9185 Product name: Recombinant human GGCX protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 383-758 aa of BC013979 Sequence: LTQGYNNWTNGLYGYSWDMMVHSRSHQHVKITYRDGRTGELGYLNPGVFTQSRRWKDHADMLKQYATCLSRLLPKYNVTEPQIYFDIWVSINDRFQQRIFDPRVDIVQAAWSPFQRTSWVQPLLMDLSPWRAKLQEIKSSLDNHTEVVFIADFPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGSETGPLPPELQPLLEGEVKGGPEPTPLVQTFLRRQQRLQEIERRRNTPFHERFFRFLLRKLYVFRRSFLMTCISLRNLILGRPSLEQLAQEVTYANLRPFEAVGELNPSNTDSSHSNPPESNPDPVHSEF Predict reactive species
Full Name	gamma-glutamyl carboxylase
Calculated Molecular Weight	758 aa, 88 kDa
Observed Molecular Weight	88 kDa
GenBank Accession Number	BC013979
Gene Symbol	GGCX
Gene ID (NCBI)	2677
RRID	AB_2110874
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P38435
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GGCX(Gamma-glutamyl carboxylase) is also named as GC and belongs to the vitamin K-dependent gamma-carboxylase family. This 94 kDa (including all modifications, such as the five N-linked glycosylations), is a 5-pass transmembrane protein and a key regulator of blood coagulation(PMID:20518534). It mediates the vitamin K-dependent carboxylation of glutamate residues to calcium-binding gamma-carboxyglutamate (Gla) residues with the concomitant conversion of the reduced hydroquinone form of vitamin K to vitamin K epoxide. Defects in GGCX are a cause of combined deficiency of vitamin K-dependent clotting factors type 1 (VKCFD1) and pseudoxanthoma elasticum-like disorder with multiple coagulation factor deficiency (PXEL-MCFD)(PMID:9845520;17110937).

Protocols

Product Specific Protocols
IHC protocol for GGCX antibody 16209-1-AP	Download protocol
IP protocol for GGCX antibody 16209-1-AP	Download protocol
WB protocol for GGCX antibody 16209-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-GGCX (16209-1-AP) has 13 citations published in journals including Nature, Blood, Nature Communications, Cell Reports, JCI Insight, Journal of Cell Biology, Cells, Journal of Nutritional Biochemistry, Current Issues in Molecular Biology, Methods in Enzymology, Oncotarget, and Cell Research. Associated research fields span vitamin K-dependent γ-carboxylation, metabolic stress, osteocalcin biology, endothelial function, calcium homeostasis, and cancer.

Species	Application	Title
		Nature Molecular basis of vitamin K driven γ-carboxylation at membrane interface Authors - Qing Cao View Article
		Blood Characterization of vitamin K-dependent carboxylase mutations that cause bleeding and nonbleeding disorders. Authors - Jian-Ke Tie View Article
mouse,pig	WB,IP	Nat Commun GGCX promotes Eurasian avian-like H1N1 swine influenza virus adaption to interspecies receptor binding Authors - Jiahui Zou KD Validated View Article
human,mouse	WB,IP	Cell Rep Vitamin K-dependent carboxylation regulates Ca2+ flux and adaptation to metabolic stress in β cells Authors - Julie Lacombe View Article
human	WB	JCI Insight VKOR paralog VKORC1L1 supports vitamin K-dependent protein carboxylation in vivo. Authors - Julie Lacombe View Article
mouse	WB	J Cell Biol GGCX and VKORC1 inhibit osteocalcin endocrine functions. Authors - Mathieu Ferron View Article