Tested Applications
| Positive WB detected in | K-562 cells, MCF-7 cells, C6 cells, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16569-1-AP targets PPP2R2A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9851 Product name: Recombinant human PPP2R2A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 99-447 aa of BC041071 Sequence: IRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCNTFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYMMTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTGSYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAWHPKENIIAVATTNNLYIFQDKVN Predict reactive species |
| Full Name | protein phosphatase 2 (formerly 2A), regulatory subunit B, alpha isoform |
| Calculated Molecular Weight | 477 aa, 52 kDa |
| Observed Molecular Weight | 50 kDa |
| GenBank Accession Number | BC041071 |
| Gene Symbol | PPP2R2A |
| Gene ID (NCBI) | 5520 |
| RRID | AB_2878280 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P63151 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The serine/threonine protein phosphatase 2A (PP2A) is a master regulator of the complex cellular signaling that occurs during all stages of mammalian development. PPP2R2A, also known as B55A or PR55A, is a regulatory subunit of PP2A expressed in an Akt-dependent manner in epidermis during barrier formation. PPP2R2A participates in the negative control of cell growth and division. PPP2R2A has been proved to be a tumor suppressor that can inhibit the proliferation of a variety of cancer cells, such as prostate cancer cells(PMID: 21872824).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PPP2R2A antibody 16569-1-AP | Download protocol |
| IHC protocol for PPP2R2A antibody 16569-1-AP | Download protocol |
| WB protocol for PPP2R2A antibody 16569-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PPP2R2A polyclonal antibody (Cat# 16569-1-AP) has 7 citations published in Nature Communications, J Exp Clin Cancer Res, Environ Pollut, EMBO Rep, Cell Div, Cell Physiol Biochem, and Herz. Research fields span neuroscience (axon initial segment signaling), oncology (hepatocellular carcinoma, lung cancer), environmental toxicology, psychiatry (depression), obstetrics (preeclampsia), and cardiology (myocardial ischemia/reperfusion injury). Applications cited include WB and IF across human, mouse, and rat species.
| Species | Application | Title |
|---|---|---|
Nat Commun A distinct PP2A subunit regulates local protein phosphorylation at the axon initial segment. | ||
J Exp Clin Cancer Res Non-canonical activation of MAPK signaling by the lncRNA ASH1L-AS1-encoded microprotein APPLE through inhibition of PP1/PP2A-mediated ERK1/2 dephosphorylation in hepatocellular carcinoma | ||
Environ Pollut The role of miR-222-2p in exosomes secreted by hexavalent chromium-induced premature senescent hepatocytes as a SASP component | ||
EMBO Rep CIP2A deficiency promotes depression-like behaviors in mice through inhibition of dendritic arborization | ||
Cell Div PPP2R2A inhibition contributes to preeclampsia by regulating the proliferation, apoptosis, and angiogenesis modulation potential of mesenchymal stem cells | ||
Cell Physiol Biochem Quantitative Proteomic Analysis of the Metastasis-Inhibitory Mechanism of miR-193a-3p in Non-Small Cell Lung Cancer. |
