Tested Applications
| Positive WB detected in | Jurkat cells, mouse thymus tissue, MOLT-4 cells, rat thymus tissue |
| Positive IP detected in | Jurkat cells |
| Positive IF-P detected in | human tonsillitis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16669-1-AP targets CD3 Delta in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10148 Product name: Recombinant human CD3D protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 22-171 aa of BC070321 Sequence: FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK Predict reactive species |
| Full Name | CD3d molecule, delta (CD3-TCR complex) |
| Calculated Molecular Weight | 171 aa, 19 kDa |
| Observed Molecular Weight | 20-25 kDa |
| GenBank Accession Number | BC070321 |
| Gene Symbol | CD3 Delta |
| Gene ID (NCBI) | 915 |
| RRID | AB_10598004 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P04234 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells. CD3 delta/CD3D is a single-pass type I membrane protein which consists of an extracellular domain of 84 amino acids, a transmembrane region, and a cytoplasmic domain of 45 amino acids. Defects in CD3 delta are a cause of severe combined immunodeficiency.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD3 Delta antibody 16669-1-AP | Download protocol |
| IP protocol for CD3 Delta antibody 16669-1-AP | Download protocol |
| WB protocol for CD3 Delta antibody 16669-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CD3 Delta Polyclonal antibody (Cat# 16669-1-AP) has 14 citations spanning journals including Cancer Research, Cell Discovery, Cell Reports, Cell Death & Disease, Clinical Cancer Research, International Journal of Biological Macromolecules, Inflammation & Regeneration, Cell Proliferation, Journal of Nanobiotechnology, FEBS Open Bio, and Annals of Diagnostic Pathology. Research fields cover tumor immunology, T-cell biology, neuroinflammation, liver failure, HIV, and diagnostic pathology.
| Species | Application | Title |
|---|---|---|
Cancer Res Epigenetic regulation of CXCL12 plays a critical role in mediating tumor progression and the immune response in osteosarcoma. | ||
Cell Discov Single-cell transcriptomics reveals intestinal cell heterogeneity and identifies Ep300 as a potential therapeutic target in mice with acute liver failure | ||
J Nanobiotechnology Oxygen-delivery nanoparticles enhanced immunotherapy efficacy monitored by granzyme B PET imaging in malignant tumors | ||
Cell Death Dis NAD+ Metabolism-Mediated SURF4-STING Axis Enhances T-Cell Anti-Tumor Effects in the Ovarian Cancer Microenvironment | ||
Clin Cancer Res Changes in Expression of Genes Representing Key Biologic Processes after Neoadjuvant Chemotherapy in Breast Cancer, and Prognostic Implications in Residual Disease. | ||
Int J Biol Macromol A novel FITC.Chimeric antigen receptor-T cell targeting HIV-1-infected cells with FITC-conjugated antibodies for enhanced cytotoxicity |
Reviews
What customers say
The single review for this antibody was negative. The user tested it for Western Blot on thymocytes and T cells at a 1:1000 dilution and reported only unspecific results. They noted that comparison to validated negative controls did not demonstrate any specificity in their hands. Overall, the reviewer rated the product 1 out of 5 stars, indicating it failed to perform as expected in their application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Anja (Verified Customer) (12-22-2023) | The antibody was tested for western blot but only showed unspecific results. Also comparison to validated negative controls did not indicate any specificity in our hands.
 |
