Tested Applications
| Positive IHC detected in | human lung cancer tissue, human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16775-1-AP targets Apolipoprotein C1/APOC1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10119 Product name: Recombinant human APOC1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-83 aa of BC055093 Sequence: MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS Predict reactive species |
| Full Name | apolipoprotein C-I |
| Calculated Molecular Weight | 83 aa, 9 kDa |
| GenBank Accession Number | BC055093 |
| Gene Symbol | APOC1 |
| Gene ID (NCBI) | 341 |
| RRID | AB_2878314 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P02654 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Apolipoprotein C1/APOC1 antibody 16775-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The APOC1 Polyclonal antibody (Cat# 16775-1-AP) has 5 citations published in Biofabrication, Cancer Biology & Therapy, Scientific Reports, PLoS Genetics, and International Endodontic Journal. The research spans pulmonary fibrosis, glioblastoma malignancy, cholesterol transport in clear cell renal cell carcinoma, mononuclear phagocyte profiling in colorectal cancer, and lipid-associated macrophage-driven pulpitis. Applications include WB, IHC, and IF in human and rat samples.
| Species | Application | Title |
|---|---|---|
Biofabrication Lung dECM matrikine-based hydrogel reverses bleomycin-induced pulmonary fibrosis by suppressing M2 macrophage polarization | ||
Cancer Biol Ther miRNA-660-3p inhibits malignancy in glioblastoma via negative regulation of APOC1-TGFβ2 signaling pathway
| ||
Sci Rep Transcriptome analysis combined with single-cell analysis identified that APOC1 influences cholesterol transport by macrophages in ccRCC. | ||
PLoS Genet Single-cell RNA profiling reveals classification and characteristics of mononuclear phagocytes in colorectal cancer | ||
Int Endod J PLA2G7-Mediated Pro-Inflammatory Activation of Lipid-Associated Macrophages Drives Pulpitis. |
