Tested Applications
| Positive WB detected in | NIH/3T3 cells, human heart tissue, mouse brain tissue, PC-12 cells |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16777-1-AP targets NEDD8 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.
| Tested Reactivity | human, mouse, rat, monkey |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10154 Product name: Recombinant human NEDD8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-81 aa of BC104664 Sequence: MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ Predict reactive species |
| Full Name | neural precursor cell expressed, developmentally down-regulated 8 |
| Calculated Molecular Weight | 81 aa, 9 kDa |
| Observed Molecular Weight | 6-10 kDa |
| GenBank Accession Number | BC104664 |
| Gene Symbol | NEDD8 |
| Gene ID (NCBI) | 4738 |
| RRID | AB_10598467 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15843 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NEDD8 (neural precursor cell-expressed developmentally down-regulated gene 8) is a small ubiquitin-like protein that shares 60% sequence identity and 80% homology with ubiquitin [PMID:9353319]. NEDD8 is conjugated to substrate proteins in a process known as neddylation. NEDD8 forms a thioester bond with APPBP1-Uba3, the E1 enzyme. Activated NEDD8 then transfers to Ubc12, the E2 enzyme . Ultimately, E2 loaded with NEDD8 binds a substrate protein lysine residue and forms an isopeptide bond by E3 ligase [PMID:18802447].
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NEDD8 antibody 16777-1-AP | Download protocol |
| IHC protocol for NEDD8 antibody 16777-1-AP | Download protocol |
| WB protocol for NEDD8 antibody 16777-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The NEDD8 Polyclonal antibody (Cat# 16777-1-AP) has 20 total citations appearing in journals including Nature Neuroscience, Cell Death & Disease, Journal of Translational Medicine, iScience, Journal of Virology, Neuropsychopharmacology, and Journal of Experimental & Clinical Cancer Research. Research fields covered neddylation biology, cancer (breast, prostate, HCC, ovarian, head and neck), neuroscience, virology, reproductive biology, sepsis/inflammation, cardiology, and dermatology.
| Species | Application | Title |
|---|---|---|
Nat Neurosci Identification of NUB1 as a suppressor of mutant Huntington toxicity via enhanced protein clearance. | ||
J Exp Clin Cancer Res Neddylation activated TRIM25 desensitizes triple-negative breast cancer to paclitaxel via TFEB-mediated autophagy | ||
Research (Wash D C) Inhibiting TRIM21 Neddylation Rejuvenates Oocyte Quality in PCOS by Regulating Ubiquitination of CPT1A. | ||
Cell Death Dis UBE2M-mediated neddylation modification stabilizes VEGFR2 to delay pulmonary vascular endothelial cell senescence. | ||
J Transl Med UBE2M promotes malignant phenotypes of prostate cancer through mediating NAA10 neddylation. | ||
J Transl Med TC2N inhibits distant metastasis and stemness of breast cancer via blocking fatty acid synthesis |
Reviews
What customers say
The product has one user review. Jose Delgado rated it 5 stars in September 2021 after using it for Western Blot at a 1:1000 dilution (lot 000082289). He reported a strong signal, indicating the antibody performed well for his application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Jose (Verified Customer) (09-14-2021) | Strong signal
|
