Tested Applications
| Positive WB detected in | LPS and Protein transport inhibitor treated THP-1 cells, human adrenal gland tissue, A431 cells |
| Positive IHC detected in | human tonsillitis tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | LPS treated THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16806-1-AP targets IL-1 beta in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig, rabbit, chicken, zebrafish, sheep, duck |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10295 Product name: Recombinant human IL-1 beta protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-269 aa of BC008678 Sequence: MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS Predict reactive species |
| Full Name | interleukin 1, beta |
| Calculated Molecular Weight | 269 aa, 31 kDa |
| Observed Molecular Weight | 30-35 kDa |
| GenBank Accession Number | BC008678 |
| Gene Symbol | IL1B |
| Gene ID (NCBI) | 3553 |
| ENSEMBL Gene ID | ENSG00000125538 |
| RRID | AB_10646432 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01584 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Interleukin-1 is a pro-inflammatory cytokine with multiple biological effects. The IL-1 gene family encodes three proteins: IL-1α, IL-1β and their naturally occurring inhibitor Il-1RN. IL-1 Beta(IL-1β), mainly produced by blood monocytes and tissue macrophages, has been implicated in mediating both acute and chronic inflammation. IL-1β is known to be involved in a variety of cellular activities, including cell proliferation, differentiation and apoptosis. IL-1β is emerging as a key mediator of carcinogenesis that characterizes host-environment interactions. Human IL-1β is synthesized as a 31 kDa precursor. To gain activity, the precursor must be cleaved by caspase-1 between Asp116 and Ala117 to yield a 17 kDa mature form.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IL-1 beta antibody 16806-1-AP | Download protocol |
| IHC protocol for IL-1 beta antibody 16806-1-AP | Download protocol |
| WB protocol for IL-1 beta antibody 16806-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The IL-1 beta Polyclonal antibody (catalog number 16806-1-AP) has 1,175 citations. These appear in high-impact journals including Science, Cell, Immunity, Nature Communications, Nature Metabolism, Nature Aging, Cancer Research, Neuron, Cell Death & Disease, Advanced Science, Theranostics, and Journal of Neuroinflammation. Research fields span inflammation and the NLRP3 inflammasome, pyroptosis, cellular senescence, neuroinflammation, cancer, metabolic and cardiovascular disease, osteoarthritis, and wound healing, with applications mainly in Western blot, immunohistochemistry, and immunofluorescence.
| Species | Application | Title |
|---|---|---|
Science Nucleotide metabolic rewiring enables NLRP3 inflammasome hyperactivation in obesity. | ||
Cell Migratory Neural Crest Cells Phagocytose Dead Cells in the Developing Nervous System. | ||
Imeta Prophylactic supplementation with Bifidobacterium infantis or its metabolite inosine attenuates cardiac ischemia/reperfusion injury | ||
Innovation (Camb) Ozone exposure and increased risk of age-related macular degeneration: Evidence from nationwide cohort and toxicological studies | ||
Immunity Omega-3 fatty acids prevent inflammation and metabolic disorder through inhibition of NLRP3 inflammasome activation. | ||
Exploration (Beijing) Activating Ferroptosis of M1 Macrophages: A Novel Mechanism of Asiaticoside Encapsuled in GelMA for Anti-Inflammation in Diabetic Wounds. |
Reviews
What customers say
All three reviews are 5-star ratings. The antibody performed well in Western Blot on liver tissue at 1:1000 dilution, described as "best for Western." It was also successfully used in Immunofluorescence on PC3 cells at 1:200 and 1:50 dilutions, with one reviewer noting the use of an anti-rabbit AF 594 secondary antibody. Overall, users report reliable performance across both WB and IF applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
MALLIKARJUNA (Verified Customer) (11-07-2025) | BEST FOR WESTERN
|
Margarita (Verified Customer) (06-06-2023) |
 |
Margarita (Verified Customer) (06-22-2022) | Secondary antibody: Anti-Rabbit AF 594
 |
