Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

SQRDL Polyclonal antibody

SQRDL Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF-P, IP, ELISA

CGI 44, CGI-44, EC:1.8.5.8, SQOR, Sulfide dehydrogenase-like

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for SQRDL in ?

Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, HT-29 cells, HepG cells, THP-1 cells
Positive IP detected inHeLa cells
Positive IHC detected inmouse brain tissue, human colon cancer tissue, human liver cancer tissue, human lung tissue, human spleen tissue, human testis tissue, mouse liver tissue, rat liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17256-1-AP targets SQRDL in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10762

Product name: Recombinant human SQRDL protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 100-450 aa of BC016836

Sequence: GRPTASVIPSGVEWIKARVTELNPDKNCIHTDDDEKISYRYLIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWKALQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTSLGAIFGVKKYADALQEIIQERNLTVNYKKNLIEVRADKQEAVFENLDKPGETQVISYEMLHVTPPMSPPDVLKTSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTISVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKADLMPFLYWNMMLRGYWGGPAFLRKLFHLGMS

Predict reactive species
Full Name sulfide quinone reductase-like (yeast)
Calculated Molecular Weight 450 aa, 50 kDa
Observed Molecular Weight 50 kDa
GenBank Accession NumberBC016836
Gene Symbol SQRDL
Gene ID (NCBI) 58472
RRIDAB_2195894
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y6N5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SQRDL(Sulfide:quinone oxidoreductase, mitochondrial) catalyzes the oxidation of hydrogen sulfide, with the help of a quinone.Although the SQRDL precursor protein displays a molecular weight of 50 kDa,a prominent band at about 46 kDa is detected by western blot. This discrepancy reflects the cleavage of an N-terminal targeting sequence of 4 kDa during the import of the protein into the mitochondria(PMID:22067608).SQRDL is one of the enzymes involved in H2S signaling in a discrete population of neurons, oligodendrocytes, and endothelial cells.

Protocols

Product Specific Protocols
IF protocol for SQRDL antibody 17256-1-APDownload protocol
IHC protocol for SQRDL antibody 17256-1-APDownload protocol
IP protocol for SQRDL antibody 17256-1-APDownload protocol
WB protocol for SQRDL antibody 17256-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The SQRDL Polyclonal antibody (Cat# 17256-1-AP) has 40 total citations. Citations appear in journals including Cell, Cell Metab, Nat Commun, Nat Chem Biol, PNAS, Redox Biology, EMBO Mol Med, Br J Pharmacol, J Biol Chem, FASEB J, and Hum Mol Genet. Research fields span hydrogen sulfide metabolism, mitochondrial bioenergetics, oxidative stress, cardiovascular disease, neurology, ferroptosis, angiogenesis, metabolic syndrome, and CoQ deficiency.

SpeciesApplicationTitle
mouseWB

Cell

Endogenous Hydrogen Sulfide Production Is Essential for Dietary Restriction Benefits.

Authors - Christopher Hine
  • KD Validated
mouseWB

Cell Metab

Mitochondrial dysfunction reveals H(2)S-mediated synaptic sulfhydration as a potential mechanism for autism-associated social defects.

Authors - Panpan Xian
rat,mouseWB

Nat Commun

Sulfide catabolism ameliorates hypoxic brain injury.

Authors - Eizo Marutani
  • KD Validated
humanWB

Redox Biol

Widespread S-persulfidation in activated macrophages as a protective mechanism against oxidative-inflammatory stress

Authors - Talal Salti
mouseWB,IHC

Redox Biol

Sulfide:quinone oxidoreductase alleviates ferroptosis in acute kidney injury via ameliorating mitochondrial dysfunction of renal tubular epithelial cells

Authors - Fangfang Cai
humanWB

Redox Biol

Hydrogen sulfide as an anti-calcification stratagem in human aortic valve: Altered biogenesis and mitochondrial metabolism of H2S lead to H2S deficiency in calcific aortic valve disease

Authors - Zsolt Combi
Loading...
||
New chat

Able™

正在加载,请稍候...