Use Able AI chat for product recommendations

FGF1 Polyclonal antibody

FGF1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 17400-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

FGF-1, Endothelial cell growth factor, Fibroblast growth factor 1, HBGF-1, Heparin-binding growth factor 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, mouse spinal cord tissue, mouse heart tissue, rat heart tissue, rat brain tissue
Positive IHC detected inhuman colon cancer tissue, human breast cancer tissue, human lung cancer tissue, mouse brain tissue, rat brain tissue, rat kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:5000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17400-1-AP targets FGF1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11366

Product name: Recombinant human FGF1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-155 aa of BC032697

Sequence: MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Predict reactive species
Full Name fibroblast growth factor 1 (acidic)
Calculated Molecular Weight 155 aa, 17 kDa
Observed Molecular Weight 17 kDa
GenBank Accession NumberBC032697
Gene Symbol FGF1
Gene ID (NCBI) 2246
RRIDAB_2103758
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP05230
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fibroblast growth factor 1 (FGF1), also known as acidic fibroblast growth factor (aFGF) and heparin-binding growth factor 1 (HBGF-1), is a 17-18 kDa signaling protein. As a member of the FGF family, it possesses broad mitogenic and cell survival activities, playing critical roles in embryonic development, tissue repair, angiogenesis, and organogenesis. FGF1 exerts its pleiotropic effects by binding to and activating its tyrosine kinase receptors, FGFR1 through FGFR4, in a process that is potentiated by cell-surface heparan sulfate proteoglycans. This activation initiates several downstream signaling cascades, including the MAPK/ERK and AKT pathways. Originally purified in 1975 and distinguished from its homolog FGF2 by its acidic isoelectric point, FGF1 is unique in that it lacks a classical signal peptide and is secreted via a non-classical, stress-induced pathway involving S100A13 and SYT1. Beyond its well-established extracellular functions in wound healing and as a potent inducer of DNA synthesis, FGF1 also possesses intracellular activities and can translocate to the nucleus to influence cell survival.

Protocols

Product Specific Protocols
IF protocol for FGF1 antibody 17400-1-APDownload protocol
IHC protocol for FGF1 antibody 17400-1-APDownload protocol
WB protocol for FGF1 antibody 17400-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseWB

Neuropharmacology

Non-mitogenic fibroblast growth factor 1 protects against ischemic stroke by regulating microglia/macrophage polarization through Nrf2 and NF-κB pathways.

Authors - Confidence Dordoe
humanWB

Life Sci

A derivant of ginsenoside CK and its inhibitory effect on hepatocellular carcinoma.

Authors - Jingjing Zhang
pigWB

Physiol Rep

Sitagliptin therapy improves myocardial perfusion and arteriolar collateralization in chronically ischemic myocardium: A pilot study

Authors - Sharif A Sabe
mouse,humanWB

Cell Death Discov

CircZBTB46 alleviates metabolic dysfunction-associated steatotic liver disease by targeting miRNA-326/FGF1 axis.

Authors - Qing-Min Zeng
humanWB

Adv Sci (Weinh)

Lipid-Driven OLR1/FOXM1/FGF19 Axis Orchestrates Crosstalk in an Epithelial-Fibroblast Positive Feedback Promoting Progesterone Resistance in Endometrial Cancer.

Authors - Xingchen Li
mouseWB

J Cereb Blood Flow Metab

Saturated fatty acids stimulate cytokine production in tanycytes via the PP2Ac-dependent signaling pathway

Authors - Danyang Liu
Loading...
||
New chat

Able

正在加载,请稍候...