Featured Product
KD/KO Validated

RAB1B Polyclonal antibody

RAB1B Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 17824-1-AP

Publications (19)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (3)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

EC:3.6.5.2, Ras related protein Rab 1B, Ras-related protein Rab-1B

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICC

WB analysis using 17824-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 17824-1-AP (RAB1B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HAP1 using 17824-1-AP
HAP1 (WT and RAB1A and RAB1B KO) lysates prepared with RIPA buffer, 30 μg of protein loaded. 17824-1-AP incubated at 1:500 at 4°C overnight in 5% milk in TBST. Ponceau stained transfers shown for each blot. These data were performed and provided by YCharOS in partnership with Proteintech. YCharOS is an open science company with a mission to characterise all commercial antibodies to improve scientific reproducibility and transparency.
×
HAP1 (WT and RAB1A and RAB1B KO) lysates prepared with RIPA buffer, 30 μg of protein loaded. 17824-1-AP incubated at 1:500 at 4°C overnight in 5% milk in TBST. Ponceau stained transfers shown for each blot. These data were performed and provided by YCharOS in partnership with Proteintech. YCharOS is an open science company with a mission to characterise all commercial antibodies to improve scientific reproducibility and transparency.
WB analysis of HeLa using 17824-1-AP
WB result of RAB1B antibody (17824-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RAB1B transfected HeLa cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human heart using 17824-1-AP
Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 17824-1-AP (RAB1B Antibody) at dilution of 1:200 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human heart using 17824-1-AP
Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 17824-1-AP (RAB1B Antibody) at dilution of 1:200 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary cancer using 17824-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 17824-1-AP (RAB1B antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse heart using 17824-1-AP
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 17824-1-AP (RAB1B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of NIH/3T3 using 17824-1-AP
Immunofluorescent analysis of NIH/3T3 cells using 17824-1-AP (RAB1B antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HeLa using 17824-1-AP
Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using RAB1B antibody (17824-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RAB1B in ?

Overview

Tested Applications
Product Information
Publications (19)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	A375 cells, HeLa cells, HAP1, A431 cells, NIH/3T3 cells
Positive IHC detected in	human heart tissue, human ovary cancer tissue, mouse heart tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HeLa cells, NIH/3T3 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:6000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17824-1-AP targets RAB1B in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	human, mouse, rat, pig, monkey
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag12197 Product name: Recombinant human RAB1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC071169 Sequence: MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC Predict reactive species
Full Name	RAB1B, member RAS oncogene family
Calculated Molecular Weight	201 aa, 22 kDa
Observed Molecular Weight	22-25 kDa
GenBank Accession Number	BC071169
Gene Symbol	RAB1B
Gene ID (NCBI)	81876
RRID	AB_2237881
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9H0U4
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ras-related protein Rab-1B (RAB1B) belongs to the small GTPase superfamily and Rab family. Rab1b, a GTPase regulating secretory transport, was recently associated with targeting proteins to LDs in a Drosophila RNAi screen. Rab1b recruits lipid-synthesizing enzymes, facilitating Lipid droplets (LDs) growth. The small GTPase Rab1b interacts with diacylglycerol acyltransferase 2 to facilitate its targeting to the surface of lipid droplets (PMID: 38809969). Rab1b, an extensively studied and established master regulator of ER-to-Golgi transport. The mechanism of Rab1b's function is to promote ER to LD surface targeting of those triglyceride-synthesizing enzymes that can associate with the unique lipid monolayer comprising the LD surface (PMID: 38809969). Rab1b is a regulatory protein involved in both COPI and COPII transport (PMID: 17429068). RAB1B may be cross-reactions with both RAB1A.

Protocols

Product Specific Protocols
IF protocol for RAB1B antibody 17824-1-AP	Download protocol
IHC protocol for RAB1B antibody 17824-1-AP	Download protocol
WB protocol for RAB1B antibody 17824-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-Rab1A/Rab1B antibody (Cat# 17824-1-AP) has 19 citations published in journals including Cancer Cell, Nature Cell Biology, Neuron, Science Advances, PNAS, Developmental Cell, EMBO Journal, Journal of Virology, Frontiers in Pharmacology, Oncology Reports, Veterinary Microbiology, Journal of Cancer, International Journal of Legal Medicine, Biology Open, F1000Research, and bioRxiv. Research fields span intracellular trafficking/Golgi biology, autophagy, cancer, virology, lipid metabolism, neurobiology, angiogenesis, and forensic medicine.

Species	Application	Title
human	WB	Cancer Cell Rab1A Is an mTORC1 Activator and a Colorectal Oncogene. Authors - Janice D Thomas View Article
human	WB	Nat Cell Biol A CREB3-ARF4 signalling pathway mediates the response to Golgi stress and susceptibility to pathogens. Authors - Reiling Jan H JH View Article
human	WB,IF	Nat Cell Biol A dual role of ERGIC-localized Rabs in TMED10-mediated unconventional protein secretion Authors - Yuxin Sun KD Validated View Article
mouse	WB	Neuron Profiling of purified autophagic vesicle degradome in the maturing and aging brain Authors - Emmanouela Kallergi View Article
		Sci Adv Rab1b facilitates lipid droplet growth by ER-to-lipid droplet targeting of DGAT2 Authors - Yehonathan Malis View Article
monkey	IF	Proc Natl Acad Sci U S A Vibrio MARTX toxin processing and degradation of cellular Rab GTPases by the cytotoxic effector Makes Caterpillars Floppy Authors - Alfa Herrera View Article