Tested Applications
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17862-1-AP targets CACNG7 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12334 Product name: Recombinant human CACNG7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 154-275 aa of BC093869 Sequence: SSINDEVMNRPSSSEQYFHYRYGWSFAFAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRGRSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC Predict reactive species |
| Full Name | calcium channel, voltage-dependent, gamma subunit 7 |
| Calculated Molecular Weight | 275 aa, 31 kDa |
| GenBank Accession Number | BC093869 |
| Gene Symbol | CACNG7 |
| Gene ID (NCBI) | 59284 |
| RRID | AB_2878456 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P62955 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CACNG7 antibody 17862-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CACNG7 Polyclonal antibody (Cat# 17862-1-AP) has 1 citation. It was used in Western blot in a study published in Molecular Therapy Nucleic Acids (2020), investigating how circRNA CDR1as promotes pulmonary artery smooth muscle cell calcification by upregulating CAMK2D and CNN3 via sponging miR-7-5p. The research falls within the fields of pulmonary vascular biology, calcification, and non-coding RNA-mediated gene regulation.
| Species | Application | Title |
|---|---|---|
Mol Ther Nucleic Acids circRNA CDR1as Promotes Pulmonary Artery Smooth Muscle Cell Calcification by Upregulating CAMK2D and CNN3 via Sponging miR-7-5p. |
