Featured Product
KD/KO Validated

NUBP1 Polyclonal antibody

NUBP1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 18011-1-AP

Publications (1)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, ELISA

Synonyms

Cytosolic Fe-S cluster assembly factor NUBP1, NBP, NBP 1, NBP1, Nbp35

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHC

WB analysis using 18011-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 18011-1-AP (NUBP1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 18011-1-AP
WB result of NUBP1 antibody (18011-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NUBP1 transfected HeLa cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of Jurkat using 18011-1-AP
IP result of anti-NUBP1 (IP:18011-1-AP, 4ug; Detection:18011-1-AP 1:300) with Jurkat cells lysate 3600ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach using 18011-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 18011-1-AP (NUBP1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse kidney using 18011-1-AP
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 18011-1-AP (NUBP1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human kidney using 18011-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 18011-1-AP (NUBP1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 18011-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 18011-1-AP (NUBP1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human renal cell carcinoma using 18011-1-AP
Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 18011-1-AP (NUBP1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse lung using 18011-1-AP
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 18011-1-AP (NUBP1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat kidney using 18011-1-AP
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 18011-1-AP (NUBP1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NUBP1 in ?

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	A549 cells, HeLa cells, LNCaP cells
Positive IP detected in	Jurkat cells
Positive IHC detected in	human stomach tissue, mouse kidney tissue, human kidney tissue, mouse lung tissue, rat kidney tissue, human renal cell carcinoma tissue, human placenta tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:8000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

18011-1-AP targets NUBP1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag12510 Product name: Recombinant human NUBP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-309 aa of BC100290 Sequence: MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKMKTVKHKILVLSGKGGVGKSTFSAHLAHGLAEDENTQIALLDIDICGPSIPKIMGLEGEQYVEDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS Predict reactive species
Full Name	nucleotide binding protein 1 (MinD homolog, E. coli)
Calculated Molecular Weight	309 aa, 33 kDa
Observed Molecular Weight	36-40 kDa
GenBank Accession Number	BC100290
Gene Symbol	NUBP1
Gene ID (NCBI)	4682
RRID	AB_2935446
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P53384
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for NUBP1 antibody 18011-1-AP	Download protocol
IP protocol for NUBP1 antibody 18011-1-AP	Download protocol
WB protocol for NUBP1 antibody 18011-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The NUBP1 Polyclonal antibody (Cat# 18011-1-AP) has 1 total citation. It appears in Science Advances (IF 13.9), published in 2023. The cited study investigated autophagy's role in supporting mitochondrial metabolism through iron homeostasis regulation in pancreatic cancer, using the antibody for Western blot in human samples. The research field encompasses autophagy, mitochondrial biology, and oncology.

Species	Application	Title
human	WB	Sci Adv Autophagy supports mitochondrial metabolism through the regulation of iron homeostasis in pancreatic cancer Authors - Subhadip Mukhopadhyay View Article