SGCG Polyclonal antibody

SGCG Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 18102-1-AP

Publications (6)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

35 kDa dystrophin-associated glycoprotein, Gamma sarcoglycan, Gamma-sarcoglycan, Gamma-SG

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHC

WB analysis of human skeletal muscle using 18102-1-AP
human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 18102-1-AP (SGCG antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 18102-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 18102-1-AP (SGCG antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human heart using 18102-1-AP
human heart tissue were subjected to SDS PAGE followed by western blot with 18102-1-AP (SGCG antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse heart using 18102-1-AP
mouse heart tissue were subjected to SDS PAGE followed by western blot with 18102-1-AP (SGCG Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of mouse heart using 18102-1-AP
IP result of anti-SGCG (IP:18102-1-AP, 4ug; Detection:18102-1-AP 1:1000) with mouse heart tissue lysate 4000ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human heart using 18102-1-AP
Immunohistochemical analysis of paraffin-embedded human heart using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human heart using 18102-1-AP
Immunohistochemical analysis of paraffin-embedded human heart using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human kidney using 18102-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human kidney using 18102-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 18102-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 18102-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human skin using 18102-1-AP
Immunohistochemical analysis of paraffin-embedded human skin using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human skin using 18102-1-AP
Immunohistochemical analysis of paraffin-embedded human skin using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung using 18102-1-AP
Immunohistochemical analysis of paraffin-embedded human lung using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung using 18102-1-AP
Immunohistochemical analysis of paraffin-embedded human lung using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary using 18102-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary using 18102-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SGCG in ?

Overview

Tested Applications
Product Information
Publications (6)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse heart tissue, human skeletal muscle tissue, human heart tissue, mouse skeletal muscle tissue, rat heart tissue
Positive IP detected in	mouse heart tissue
Positive IHC detected in	human heart tissue, human kidney tissue, human lung tissue, human ovary tissue, human placenta tissue, human skin tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:8000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

18102-1-AP targets SGCG in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag12402 Product name: Recombinant human SGCG protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-291 aa of BC074777 Sequence: MVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYLFVLLLLIILVVNLALTIWILKVMWFSPAGMGHLCVTKDGLRLEGESEFLFPLYAKEIHSRVDSSLLLQSTQNVTVNARNSEGEVTGRLKVGPKMVEVQNQQFQINSNDGKPLFTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRSLSMDAPRGVHIQAHAGKIEALSQMDILFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVSTTCQEHSHICL Predict reactive species
Full Name	sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein)
Calculated Molecular Weight	291 aa, 32 kDa
Observed Molecular Weight	35-38 kDa
GenBank Accession Number	BC074777
Gene Symbol	SGCG
Gene ID (NCBI)	6445
RRID	AB_2286186
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q13326
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for SGCG antibody 18102-1-AP	Download protocol
IP protocol for SGCG antibody 18102-1-AP	Download protocol
WB protocol for SGCG antibody 18102-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-Utrophin antibody (Cat# 18102-1-AP) has 6 total citations published in journals including Advanced Science, Skeletal Muscle, PLoS One, Human Gene Therapy Methods, and Molecular Vision. The research fields span Duchenne and Becker muscular dystrophy, dystrophin expression and regulation, neuromuscular transmission, muscle membrane protein interactions, gene therapy optimization, and transcriptional target identification in mouse and human models.

Species	Application	Title
mouse	WB	Adv Sci (Weinh) Sirt6 Mono-ADP-Ribosylates YY1 to Promote Dystrophin Expression for Neuromuscular Transmission Authors - Wei Zhang View Article
mouse	WB,IP,IF	Skelet Muscle Novel γ-sarcoglycan interactors in murine muscle membranes. Authors - Tara C Smith View Article
human	IF	PLoS One Correlation of Utrophin Levels with the Dystrophin Protein Complex and Muscle Fibre Regeneration in Duchenne and Becker Muscular Dystrophy Muscle Biopsies. Authors - Narinder Janghra View Article
mouse	IHC	PLoS One Peptide-conjugated phosphodiamidate oligomer-mediated exon skipping has benefits for cardiac function in mdx and Cmah-/-mdx mouse models of Duchenne muscular dystrophy. Authors - Alison M Blain View Article
human	IF	Hum Gene Ther Methods Optimisation of internally deleted dystrophin constructs. Authors - Mojgan Reza View Article
mouse	IHC	Mol Vis Identification of HMX1 target genes: a predictive promoter model approach. Authors - Boulling Arnaud A View Article