Tested Applications
| Positive WB detected in | mouse brain tissue, A549 cells, rat brain tissue |
| Positive IP detected in | A549 cells |
| Positive IHC detected in | human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
18149-1-AP targets CPLX2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12838 Product name: Recombinant human CPLX2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-134 aa of BC093706 Sequence: MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK Predict reactive species |
| Full Name | complexin 2 |
| Calculated Molecular Weight | 134 aa, 15 kDa |
| Observed Molecular Weight | 18-20 kDa |
| GenBank Accession Number | BC093706 |
| Gene Symbol | CPLX2 |
| Gene ID (NCBI) | 10814 |
| RRID | AB_2276580 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6PUV4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Complexins are soluble proteins that regulate the activity of soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) complexes necessary for vesicle fusion. Neuronal specific complexin 1 (CPLX1) has inhibitory and stimulatory effects on exocytosis by clamping trans-SNARE complexes in a prefusion state and promoting conformational changes to facilitate membrane fusion following cell stimulation. Complexin2 (CPLX2) is a pre-synaptic protein believed to regulate neurotransmitter release from pre-synaptic terminals, it is downregulated in schizophrenic patients suffering from depression, animal models of depression and neurological disorders such as Huntington's disease in which depression is a major symptom.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CPLX2 antibody 18149-1-AP | Download protocol |
| IHC protocol for CPLX2 antibody 18149-1-AP | Download protocol |
| IP protocol for CPLX2 antibody 18149-1-AP | Download protocol |
| WB protocol for CPLX2 antibody 18149-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-Complexin 2 (18149-1-AP) has 12 citations spanning journals including Acta Pharmacologica Sinica, Free Radical Biology and Medicine, Neural Regeneration Research, Molecular Metabolism, Molecular Neurobiology, Life Sciences, Journal of Neuro-Oncology, and others. Research fields cover neuroscience (neonatal hypoxia-ischemia, stroke, neurodegeneration, glioma), metabolic regulation (glucose homeostasis, pancreatic β-cell function), endocrinology (islet hormone secretion), oncology (lung neuroendocrine tumors), and psychiatric disorders (depression, HPA axis dysfunction). Applications include WB, IF, IP, and IHC in mouse and human samples.
| Species | Application | Title |
|---|---|---|
Acta Pharmacol Sin Complexin 2 contributes to the protective effect of NAD+ on neuronal survival following neonatal hypoxia-ischemia | ||
Neural Regen Res Nicotinamide adenine dinucleotide treatment confers resistance to neonatal ischemia and hypoxia: effects on neurobehavioral phenotypes | ||
Free Radic Biol Med NOX2 Deficiency Ameliorates Cerebral Injury by Reduction of Complexin II-mediated Glutamate Excitotoxicity in Experimental Stroke.
| ||
Life Sci Geniposide improves depression-like behavior in prenatal stress male offspring through restoring HPA axis- and glucocorticoid receptor-associated dysfunction | ||
Mol Metab Long non-coding RNA LncCplx2 regulates glucose homeostasis and pancreatic β cell function | ||
Mol Neurobiol L116 Deletion in CSPα Promotes α-Synuclein Aggregation and Neurodegeneration |
Reviews
What customers say
The single review for this antibody reports a 5-star rating for Western Blot at a 1:2500 dilution, validated on N2a cells and mouse spinal cord tissue. No additional written comments were provided.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
julie (Verified Customer) (03-28-2022) | --
|
