Tested Applications
| Positive WB detected in | A549 cells, HEK-293T cells, HeLa cells, K-562 cells, MCF-7 cells |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
18333-1-AP targets RAD18 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12944 Product name: Recombinant human RAD18 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-495 aa of BC001302 Sequence: MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEPDLKNNRILDELVKSLNFARNHLLQFALESPAKSPASSSSKNLAVKVYTPVASRQSLKQGSRLMDNFLIREMSGSTSELLIKENKSKFSPQKEASPAAKTKETRSVEEIAPDPSEAKRPEPPSTSTLKQVTKVDCPVCGVNIPESHINKHLDSCLSREEKKESLRSSVHKRKPLPKTVYNLLSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVQEIENIEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEVLSSSESDSCNSSSSDIIRDLLEEEEAWEASHKNDLQDTEISPRQNRRTRAAESAEIEPRNKRNRN Predict reactive species |
| Full Name | RAD18 homolog (S. cerevisiae) |
| Calculated Molecular Weight | 56 kDa |
| Observed Molecular Weight | 75 kDa, 85 kDa |
| GenBank Accession Number | BC001302 |
| Gene Symbol | RAD18 |
| Gene ID (NCBI) | 56852 |
| RRID | AB_2176586 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NS91 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RAD18(E3 ubiquitin-protein ligase RAD18) is lalso named as RNF73, hHR18 and belongs to the RAD18 family. It is involved in postreplication repair of UV-damaged DNA. RAD18 protein is detected in human cells as two major bands at 75 and 85 kDa by Western blot. The bands are identified as nonubiquitinated and monoubiquitinated forms of Rad18, respectively(PMID: 15509568). Monoubiquitinated RAD18 is detected mainly in the cytoplasm, whereas nonubiquitinated RAD18 is detected predominantly in the nuclei(PMID:15509568). This antibody is specific to RAD18.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RAD18 antibody 18333-1-AP | Download protocol |
| IHC protocol for RAD18 antibody 18333-1-AP | Download protocol |
| IP protocol for RAD18 antibody 18333-1-AP | Download protocol |
| WB protocol for RAD18 antibody 18333-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The RAD18 Polyclonal antibody (Cat# 18333-1-AP) has 16 citations across 14 journals, including Nature Communications, Nucleic Acids Research, Theranostics, Advanced Science, Cell Death & Disease, Cell Reports, Cell Oncology, NAR Cancer, Journal of Cell Science, Cell Cycle, Molecular Pharmacology, Bioengineered, and Medicine. Research fields span DNA damage response and repair, ubiquitination, meiosis, chromatin biology, and multiple cancer types (breast, liver, lung, ovarian, cervical), with applications in WB, IF, IHC, and IP.
| Species | Application | Title |
|---|---|---|
Theranostics A feedforward circuit shaped by ECT2 and USP7 contributes to breast carcinogenesis. | ||
Adv Sci (Weinh) Hepatocellular Carcinoma LINC01116 Outcompetes T Cells for Linoleic Acid and Accelerates Tumor Progression | ||
Cell Death Dis Chromatin assembly factor 1 subunit A promotes TLS pathway by recruiting E3 ubiquitin ligase RAD18 in cancer cells | ||
Cell Death Dis REV1 promotes lung tumorigenesis by activating the Rad18/SERTAD2 axis.
|
Reviews
What customers say
The single review rates this antibody 5 stars, confirming it works perfectly for visualizing endogenous Rad18 in U2OS human osteosarcoma cells at a 1:1000 dilution with overnight incubation. The reviewer noted successful performance across Western Blot, Immunohistochemistry, Immunoprecipitation, and cell culture applications, and included an image demonstrating clear endogenous protein detection.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Alexandra (Verified Customer) (03-20-2024) | The middle part of the picture is irrelevant (other sample, other antibody), but I did not want to modify the picture. The antibody works perfect, on the picture the endogenous Rad18 can be seen. It works fine for the endogenous protein visualisation in 1000x dilution, incubation ON.
 |
