Tested Applications
| Positive IHC detected in | mouse skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
18347-1-AP targets CTNNBIP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13160 Product name: Recombinant human CTNNBIP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-81 aa of BC014300 Sequence: MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ Predict reactive species |
| Full Name | catenin, beta interacting protein 1 |
| Calculated Molecular Weight | 21 kDa |
| GenBank Accession Number | BC014300 |
| Gene Symbol | CTNNBIP1 |
| Gene ID (NCBI) | 56998 |
| RRID | AB_3085562 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NSA3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CTNNBIP1 antibody 18347-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CTNNBIP1 Polyclonal antibody (Cat# 18347-1-AP) has 1 total citation. It appears in J Cancer (IF 3.4), published in 2020. The cited study investigated functional genetic variants of CTNNBIP1 and their predictive value for platinum treatment response in Chinese epithelial ovarian cancer patients, placing it in the research fields of ovarian cancer, pharmacogenomics, and platinum-based chemotherapy response.
| Species | Application | Title |
|---|---|---|
J Cancer Functional genetic variants of CTNNBIP1 predict platinum treatment response of Chinese epithelial ovarian cancer patients. |
