Tested Applications
| Positive WB detected in | HepG2 cells, HT-1080 cells, mouse lung tissue, mouse kidney tissue |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
19888-1-AP targets NPC2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13719 Product name: Recombinant human NPC2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-151 aa of BC002532 Sequence: MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL Predict reactive species |
| Full Name | Niemann-Pick disease, type C2 |
| Calculated Molecular Weight | 151 aa, 17 kDa |
| Observed Molecular Weight | 17-21 kDa |
| GenBank Accession Number | BC002532 |
| Gene Symbol | NPC2 |
| Gene ID (NCBI) | 10577 |
| RRID | AB_10639363 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P61916 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Niemann-Pick Type C (NPC) disease is a lysosomal storage disorder characterized by accumulation of unesterified cholesterol and other lipids in the endolysosomal system. NPC disease results from a defect in either of two distinct cholesterol-binding proteins: a transmembrane protein, NPC1, and a small soluble protein, NPC2. NPC1 or NPC2 deficiency models showed that the function of these two proteins within lysosomes are linked closely. NPC2 is also named human epididymis-specific protein 1 (HE1), defects of which are the cause of Niemann-Pick disease type C2, characterized as a lysosomal storage disorder that affects the viscera and the central nervous system. Recent finding suggests that NPC2 may serve as a novel intracrine/autocrine factor that controls adipocyte differentiation and function as well as potential therapeutic target for the treatment of type 2 diabetes and related metabolic disorders.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for NPC2 antibody 19888-1-AP | Download protocol |
| IHC protocol for NPC2 antibody 19888-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The NPC2 Polyclonal antibody (Cat# 19888-1-AP) has 20 citations. These appear in high-impact journals including Nature, Nature Communications, Developmental Cell, Metabolism, iScience, FASEB Journal, Cancer Research, and Journal of Biological Chemistry, among others. Research fields span cholesterol metabolism and trafficking, Niemann-Pick disease, lysosomal function, viral entry (SARS-CoV-2, flaviviruses), and cancer biology (lung, colorectal, ovarian, pancreatic). Most studies applied the antibody for Western blot, with some using immunofluorescence and IHC.
| Species | Application | Title |
|---|---|---|
Nature A CRISPR screen defines a signal peptide processing pathway required by flaviviruses. | ||
Nat Commun A genome-wide CRISPR screen identifies host factors that regulate SARS-CoV-2 entry. | ||
Nat Commun Cholesterol sulfate alleviates ulcerative colitis by promoting cholesterol biosynthesis in colonic epithelial cells | ||
Metabolism Ubiquitination of cytoplasmic HMGB1 by RNF186 regulates hepatic lipophagy in non-alcoholic fatty liver disease | ||
Dev Cell NPC1-mTORC1 Signaling Couples Cholesterol Sensing to Organelle Homeostasis and Is a Targetable Pathway in Niemann-Pick Type C. |
Reviews
What customers say
Users report positive results with this antibody across applications. For Western Blot, one reviewer noted clear and strong bands at a 1:1000 dilution, rating it 5 stars. For Immunofluorescence, another reviewer successfully stained paraffin-embedded mouse testis tissue for Npc2 (green) with DAPI counterstain (blue) at 1:200 dilution, giving it 4 stars. Overall, the antibody is well-received for producing specific, strong signals in both WB and IF applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Amy (Verified Customer) (02-06-2026) | Works really well, clear and strong band
|
Kristian (Verified Customer) (07-06-2021) | Paraffin embedded testis were stained for Npc2 (green) and DAPI (blue)
 |
