Tested Applications
| Positive WB detected in | DU 145 cells, mouse brain tissue, MG-63 cells, U2OS cells, rat skeletal muscle tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20158-1-AP targets UBTD1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14082 Product name: Recombinant human UBTD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 118-227 aa of BC007331 Sequence: YCLSPPVNLLLEHTEEESLEPPEPPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIINQPPPPQD Predict reactive species |
| Full Name | ubiquitin domain containing 1 |
| Calculated Molecular Weight | 227 aa, 26 kDa |
| Observed Molecular Weight | 26-30 kDa |
| GenBank Accession Number | BC007331 |
| Gene Symbol | UBTD1 |
| Gene ID (NCBI) | 80019 |
| RRID | AB_3741979 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9HAC8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ubiquitin domain-containing protein 1 (UBTD1) is highly evolutionary conserved and has been described to interact with E2 enzymes of the ubiquitin-proteasome system. Even if its biological functions remain largely unknown, UBTD1 expression is regulated by P53 and induces cellular senescence by stabilizing P53 through degradation of murine double minute 2 (MDM2).(PMID: 30804013,PMID: 33884955)
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for UBTD1 antibody 20158-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The UBTD1 Polyclonal antibody (Cat# 20158-1-AP) has 1 citation to date. The cited publication appeared in Frontiers in Oncology (Impact Factor 3.4), published in 2026. The study validated UBTD1 as a prognostic and immune biomarker in thyroid cancer and conducted a pan-cancer analysis, placing this citation within the fields of oncology, cancer biomarker research, and immune-related tumor biology. The application used was Western Blot in human samples.
| Species | Application | Title |
|---|---|---|
Front Oncol UBTD1: a prognostic and immune biomarker validated in thyroid cancer and pan-cancer analysis.
|



