B4GALT2 Polyclonal antibody

B4GALT2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20330-1-AP

Publications (2)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

B4Gal T2, b4Gal-T2, Beta 1,4 GalTase 2, Beta-1,4-galactosyltransferase 2, Beta-1,4-GalTase 2

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis of PC-3 using 20330-1-AP
PC-3 cells were subjected to SDS PAGE followed by western blot with 20330-1-AP (B4GALT2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse large intestine using 20330-1-AP
mouse large intestine tissue were subjected to SDS PAGE followed by western blot with 20330-1-AP (B4GALT2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse brain using 20330-1-AP
mouse brain tissue were subjected to SDS PAGE followed by western blot with 20330-1-AP (B4GALT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse ovary using 20330-1-AP
mouse ovary tissue were subjected to SDS PAGE followed by western blot with 20330-1-AP (B4GALT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse skeletal muscle using 20330-1-AP
mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 20330-1-AP (B4GALT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 20330-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer using 20330-1-AP (B4GALT2 antibody) at dilution of 1:100 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 20330-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer using 20330-1-AP (B4GALT2 antibody) at dilution of 1:100 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 20330-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer using 20330-1-AP (B4GALT2 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 20330-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer using 20330-1-AP (B4GALT2 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary using 20330-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary using 20330-1-AP (B4GALT2 antibody) at dilution of 1:100 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary using 20330-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary using 20330-1-AP (B4GALT2 antibody) at dilution of 1:100 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for B4GALT2 in ?

Overview

Tested Applications
Product Information
Publications (2)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	PC-3 cells, mouse brain tissue, mouse large intestine tissue, mouse ovary tissue, mouse skeletal muscle tissue
Positive IHC detected in	human colon cancer tissue, human ovary tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:4000
Immunohistochemistry (IHC)	IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20330-1-AP targets B4GALT2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag14046 Product name: Recombinant human B4GALT2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 60-176 aa of BC002431 Sequence: PGVLMGGRYTPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMD Predict reactive species
Full Name	UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2
Calculated Molecular Weight	372 aa, 42 kDa
Observed Molecular Weight	42-45 kDa
GenBank Accession Number	BC002431
Gene Symbol	B4GALT2
Gene ID (NCBI)	8704
RRID	AB_10693615
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O60909
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for B4GALT2 antibody 20330-1-AP	Download protocol
WB protocol for B4GALT2 antibody 20330-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The B4GALT2 Polyclonal antibody (Cat# 20330-1-AP) has 2 citations. One appeared in Journal for ImmunoTherapy of Cancer (IF 11.7), studying B4GALT2 as an immune exclusion regulator in lung adenocarcinoma via IHC. The other was published in Frontiers in Genetics (IF 3), identifying a glycosyltransferase prognostic signature in hepatocellular carcinoma using WB. Both studies were conducted in human samples, covering research fields of cancer immunology and oncology biomarker discovery.

Species	Application	Title
human	IHC	J Immunother Cancer Novel post-translational modification learning signature reveals B4GALT2 as an immune exclusion regulator in lung adenocarcinoma Authors - Pengpeng Zhang View Article
human	WB	Front Genet Identification of a Novel Glycosyltransferase Prognostic Signature in Hepatocellular Carcinoma Based on LASSO Algorithm. Authors - Zhiyang Zhou View Article