Tested Applications
| Positive WB detected in | RAW 264.7 cells, HeLa cells, human skeletal muscle tissue, mouse brain tissue, mouse lung tissue |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20352-1-AP targets PKNOX2 in WB, IHC, IF, ChIP, RIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14195 Product name: Recombinant human PKNOX2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 350-471 aa of BC045626 Sequence: MLDASNPDPAPKAKKIKSQHRPTQRFWPNSIAAGVLQQQGGAPGTNPDGSINLDNLQSLSSDSATMAMQQAMMAAHDDSLDGTEEEDEDEMEEEEEELEEEVDELQTTNVSDLGLEHSDSLE Predict reactive species |
| Full Name | PBX/knotted 1 homeobox 2 |
| Calculated Molecular Weight | 472 aa, 52 kDa |
| Observed Molecular Weight | 70 kDa, 55 kDa |
| GenBank Accession Number | BC045626 |
| Gene Symbol | PKNOX2 |
| Gene ID (NCBI) | 63876 |
| RRID | AB_10694277 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96KN3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PKNOX2, PBX/knotted 1 homeobox 2, also named as PREP2, belongs to the three-amino acid loop extension (TALE) homeobox family. As it contains a DNA-binding motif, PKNOX2 may function as a nuclear transcription factor, experiments have reported the PKNOX2 protein locates to the nucleus. It was showed that highest expression of a 4-kb PREP2 (PKNOX2) transcript in heart, brain, skeletal muscle, and ovary(PMID:11972344). Several years later, PKNOX2 was identified as one of the cis-regulated genes for alcohol addiction in mice, however it has not been reported to be associated with any similar phenotype in humans to date (PMID:19721000). The molecular weight of the protein may differ from the theoretical value.
Publications
What published studies show
Anti-PKNOX2 antibody (Cat# 20352-1-AP) has 4 total citations published in Br J Cancer, Int J Mol Sci, 3 Biotech, and Biochem Biophys Res Commun. Associated research fields include gut microbiome and colorectal cancer immunotherapy, myogenic differentiation in porcine satellite cells, lung adenocarcinoma proliferation and migration, and kidney fibrosis involving myofibroblast function.
| Species | Application | Title |
|---|---|---|
Br J Cancer Impact of gut microbiome on radiotherapy and immunotherapy efficacy in microsatellite-stable colorectal cancer: role of propionic acid and B. fragilis | ||
Int J Mol Sci LncRNA TCONS_00323213 Promotes Myogenic Differentiation by Interacting with PKNOX2 to Upregulate MyoG in Porcine Satellite Cells | ||
3 Biotech FBXW4 suppresses the proliferation and migration of lung adenocarcinoma cells by inhibiting PKNOX2 promoter methylation.
| ||
Biochem Biophys Res Commun PKNOX2 regulates myofibroblast functions and tubular cell survival during kidney fibrosis. |
