Tested Applications
| Positive WB detected in | mouse brain tissue, mouse colon tissue, HeLa cells, rat brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20760-1-AP targets FAM57B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14707 Product name: Recombinant human FAM57B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 46-140 aa of BC007892 Sequence: SVQAIMASTAGYIVSTSCKHIIDDQHWLSSAYTQFAVPYFIYDIYAMFLCHWHKHQVKGHGGDDGAARAPGSTWAIARGYLHKEFLMVLHHAAMV Predict reactive species |
| Full Name | family with sequence similarity 57, member B |
| Calculated Molecular Weight | 274 aa, 31 kDa |
| Observed Molecular Weight | 31 kDa |
| GenBank Accession Number | BC007892 |
| Gene Symbol | FAM57B |
| Gene ID (NCBI) | 83723 |
| RRID | AB_10732598 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q71RH2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for FAM57B antibody 20760-1-AP | Download protocol |
| WB protocol for FAM57B antibody 20760-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The FAM57B Polyclonal antibody (Cat# 20760-1-AP) has 1 citation. It was used in a Western Blot study published in iScience (2022), investigating lipid changes in iPSC-derived neurons and the role of FAM57B in lipid metabolism and synaptogenesis. The research falls within the fields of lipid metabolism, neurobiology, and iPSC-based disease modeling.
| Species | Application | Title |
|---|---|---|
iScience 16pdel lipid changes in iPSC-derived neurons and function of FAM57B in lipid metabolism and synaptogenesis
|
Reviews
What customers say
The single review for this antibody (rated 3/5) was for Western Blot at a 1:250 dilution using SH-SY5Y cells. The reviewer noted it is the only antibody they found that resolves FAM57B at the correct molecular weight. However, they reported the signal was not very clean in SH-SY5Y lysates, with multiple non-specific bands appearing alongside the target. Overall, the antibody demonstrates correct specificity for FAM57B but may require optimization to reduce background in certain cell lines.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Danielle (Verified Customer) (12-16-2018) | This is the only antibody I've found that resolves FAM57B at the correct size. However, the antibody is not very clean with the SH-SY5Y cells and will show multiple bands.
|
