Tested Applications
| Positive WB detected in | mouse heart tissue, rat heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20898-1-AP targets SLC47A1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15013 Product name: Recombinant human SLC47A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 449-570 aa of BC010661 Sequence: QAVCFLGFIIQLNWKKACQQAQVHANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRKQLVLRRGLLLLGVFLILLVGILVRFYVRIQ Predict reactive species |
| Full Name | solute carrier family 47, member 1 |
| Calculated Molecular Weight | 570 aa, 62 kDa |
| Observed Molecular Weight | 62 kDa, 32 and 50 kDa |
| GenBank Accession Number | BC010661 |
| Gene Symbol | SLC47A1 |
| Gene ID (NCBI) | 55244 |
| RRID | AB_2878759 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96FL8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SLC47A1 antibody 20898-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SLC47A1 Polyclonal antibody (Cat# 20898-1-AP) has 6 total citations published in Cell Death Dis, Phytomedicine, International Journal of Molecular Sciences, Frontiers in Pharmacology, Molecular Oncology, and Xenobiotica. Research fields span gastric cancer and ferroptosis, breast cancer bone metastasis, proarrhythmia and drug transport, Chinese medicine pharmacology, lipid peroxidation in drug-resistant cancer, and anti-diabetic hepatic drug distribution. All citations used the antibody for Western blot in human, mouse, or rat samples.
| Species | Application | Title |
|---|---|---|
Cell Death Dis ALDH3A2 negatively orchestrates gastric cancer progression through a synergistic induction of ferroptosis and ferroptosis-driven macrophage reprogramming. | ||
Phytomedicine Dual targeting of lipogenesis and PUFAs homeostasis by compound kushen injection suppresses breast cancer bone metastasis. | ||
Front Pharmacol A strategy for evaluating the impact of processing of Chinese meteria medica on meridian tropism: the influence of salt-water processing of phellodendri chinensis cortex on renal transport proteins | ||
Mol Oncol NCI677397 targeting USP24-mediated induction of lipid peroxidation induces ferroptosis in drug-resistant cancer cells | ||
Xenobiotica Rutaecarpine enhances the anti-diabetic activity and hepatic distribution of metformin via up-regulation of Oct1 in diabetic rats. |
