Tested Applications
| Positive WB detected in | mouse retina tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21114-1-AP targets PCMTD2 in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15347 Product name: Recombinant human PCMTD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 248-361 aa of BC033665 Sequence: RIAIRGTIKKIIHQETVSKNGNGLKNTPRFKRRRVRRRRMETIVFLDKEVFASRISNPSDDNSCEDLEEERREEEEKTPPETKPDPPVNFLRQKVLSLPLPDPLKYYLLYYREK Predict reactive species |
| Full Name | protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 2 |
| Calculated Molecular Weight | 361 aa, 41 kDa |
| Observed Molecular Weight | 38-41 kDa |
| GenBank Accession Number | BC033665 |
| Gene Symbol | PCMTD2 |
| Gene ID (NCBI) | 55251 |
| RRID | AB_3742016 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NV79 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PCMTD2 (Protein-L-isoaspartate O-methyltransferase domain-containing protein 2) has also been linked to various disease states including neurodevelopmental disorders and cancer. CUL5 E3 ligase complex can target CD247 and IL2RB through its adaptor protein PCMTD2. PCMTD2 is expressed in pigmented layer of retina.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for PCMTD2 antibody 21114-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PCMTD2 Polyclonal antibody (Cat# 21114-1-AP) has 1 total citation. It appears in Cancer Genomics Proteomics (IF 2.6, 2026), where it was used for Western blot in a study on integrated proteomics revealing ALDH1A1 as an oncogenic driver and regulatory hub in hepatocellular carcinoma. The associated research field is cancer genomics and proteomics, specifically liver cancer.
| Species | Application | Title |
|---|---|---|
Cancer Genomics Proteomics Integrated Proteomics Reveal ALDH1A1 as an Oncogenic Driver and Regulatory Hub in Hepatocellular Carcinoma. |
