Tested Applications
| Positive WB detected in | Human peripheral blood platelets tissue, mouse spleen tissue |
| Positive IP detected in | mouse serum |
| Positive IHC detected in | mouse spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21157-1-AP targets CXCL4/PF4 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, pig samples.
| Tested Reactivity | human, mouse, pig |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12345 Product name: Recombinant human PF4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC093965 Sequence: MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES Predict reactive species |
| Full Name | platelet factor 4 |
| Calculated Molecular Weight | 101 aa, 11 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC093965 |
| Gene Symbol | PF4 |
| Gene ID (NCBI) | 5196 |
| RRID | AB_2878819 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P02776 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The chemokine (C-X-C motif) ligand 4 (CXCL4) is also named as PF4 (Platelet factor-4) and SCYB4. The platelets, the most abundant source of CXCL4 in vivo, control profibrotic macrophage activation via CXCL4. (PMID: 36807143). Exogenous CXCL4 drove profibrotic activation of monocyte-derived dendritic cells in vitro (PMID: 33042127). Platelet factor-4 is a 70-amino acid protein that is released from the alpha-granules of activated platelets and binds with high affinity to heparin. Its major physiologic role appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CXCL4/PF4 antibody 21157-1-AP | Download protocol |
| IHC protocol for CXCL4/PF4 antibody 21157-1-AP | Download protocol |
| IP protocol for CXCL4/PF4 antibody 21157-1-AP | Download protocol |
| WB protocol for CXCL4/PF4 antibody 21157-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-PF4/CXCL4 (catalog no. 21157-1-AP) has 17 total citations. Journals include Advanced Science, Brain, Behavior, and Immunity, Journal of Virology, Journal of Biological Chemistry, International Journal of Molecular Medicine, Cell Biosciences, International Immunopharmacology, Molecular Neurobiology, Cancer Science, Immunology and Inflammation Disease, Toxicology and Applied Pharmacology, Amyloid, Frontiers in Bioscience, Journal of Vascular Access, and Endocrine, Metabolic and Immune Disorders – Drug Targets. Research fields span inflammation, neurodegeneration, thrombosis, cardiac fibrosis, viral infection, oncology, and ferroptosis.
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Gut Microbiota Regulates Systemic Inflammatory Response and Compensatory Anti-Inflammatory Response Syndromes by Targeting PF4(+) Macrophages in Acute Pancreatitis. | ||
Int J Mol Med Platelet activation stimulates macrophages to enhance ulcerative colitis through PF4/CXCR3 signaling | ||
Brain Behav Immun Platelet factor 4 prevents neuroinflammation and neurodegeneration in Parkinson's disease model via regulating protocadherin gamma/Pyk2 pathway. | ||
Cell Biosci Neutrophil extracellular traps promote thrombogenicity in cerebral venous sinus thrombosis. | ||
Int Immunopharmacol CXCL4:NLRP3-mediated pyroptosis product that regulates cardiac fibrosis | ||
Mol Neurobiol Regulatory Effects and Mechanisms of L-Theanine on Neurotransmitters via Liver-Brain Axis Under a High Protein Diet |
