Tested Applications
| Positive WB detected in | MOLT-4 cells, human testis tissue, THP-1 cells |
| Positive IHC detected in | mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21366-1-AP targets UGT3A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15835 Product name: Recombinant human UGT3A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 75-129 aa of BC103925 Sequence: QVISWLAPEDHQREFKKSFDFFLEETLGGRGKFENLLNVLEYLALQCSHFLNRKD Predict reactive species |
| Full Name | UDP glycosyltransferase 3 family, polypeptide A2 |
| Calculated Molecular Weight | 523 aa, 60 kDa |
| Observed Molecular Weight | 50-55 kDa |
| GenBank Accession Number | BC103925 |
| Gene Symbol | UGT3A2 |
| Gene ID (NCBI) | 167127 |
| RRID | AB_10888629 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q3SY77 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for UGT3A2 antibody 21366-1-AP | Download protocol |
| WB protocol for UGT3A2 antibody 21366-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The UGT3A2 Polyclonal antibody (Cat# 21366-1-AP) has 1 total citation. The cited publication appeared in Frontiers in Molecular Biosciences (2023) and focused on identifying small extracellular vesicle protein biomarkers for pediatric Ewing Sarcoma, using the antibody for IHC. The research field encompasses cancer biomarker discovery, extracellular vesicle biology, and pediatric oncology.
| Species | Application | Title |
|---|---|---|
Front Mol Biosci Identification of small extracellular vesicle protein biomarkers for pediatric Ewing Sarcoma |
Reviews
What customers say
The single review for this antibody reports a 3-star rating. The user tested it at a 1:500 dilution on HeLa and MT4 cells for Western Blot and noted that while the antibody does work, it produces high background. Overall, the feedback suggests the product is functional but may require optimization (e.g., adjusting dilution or blocking conditions) to reduce nonspecific signal.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Daniel (Verified Customer) (10-26-2022) | This antibody works but produces high background.
 |
