Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, mouse kidney tissue, rat kidney tissue |
| Positive IP detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21768-1-AP targets FAM117B in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16407 Product name: Recombinant human FAM117B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 49-128 aa of BC106906 Sequence: SKHSSRHHRDKERQSPFHGNHAAINQCQAPVPKSALIPVIPITKSTGSRFRNSVEGLNQEIEIIIKETGEKEEQLIPQDI Predict reactive species |
| Full Name | family with sequence similarity 117, member B |
| Calculated Molecular Weight | 589 aa, 62 kDa |
| Observed Molecular Weight | 66 kDa |
| GenBank Accession Number | BC106906 |
| Gene Symbol | FAM117B |
| Gene ID (NCBI) | 150864 |
| RRID | AB_10804757 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6P1L5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FAM117B, also named as ALS2CR13, is mapped in the genomic region covering the complete candidate region for Amyotrophic lateral sclerosis 2 (ALS2). This antibody is specific to FAM117B.
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for FAM117B antibody 21768-1-AP | Download protocol |
| WB protocol for FAM117B antibody 21768-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The FAM117B Polyclonal antibody (catalog #21768-1-AP) has 5 total citations. These appear in Cancer Research, Journal of Clinical Investigation, Cell Signaling, Experimental Cell Research, and Cell Biology International. The research fields span oncology—gastric cancer, hepatocellular carcinoma, and colorectal cancer—alongside allergic asthma and mitochondrial dysfunction, with applications including WB, IHC, IF, and IP.
| Species | Application | Title |
|---|---|---|
Cancer Res Proteomic analysis of ubiquitin ligase KEAP1 reveals associated proteins that inhibit NRF2 ubiquitination. | ||
J Clin Invest FAM117B promotes gastric cancer growth and drug resistance by targeting the KEAP1/NRF2 signaling pathway
| ||
Cell Signal GLCCI1 ameliorates mitochondrial dysfunction in allergic asthma mice via DYRK1A/FAM117B-dependent NRF2 activation | ||
Cell Biol Int FAM117B Promotes Colorectal Cancer Progression by Enhancing DYRK1A-mediated Phosphorylation of PLK2.
| ||
Exp Cell Res FAM117B Promotes Malignant Progression of Hepatocellular Carcinoma by Forming a Bidirectional Regulatory Loop with NAT10 and Activating the JAK-STAT3 Pathway.
|
