DPF1 Polyclonal antibody

DPF1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 21769-1-AP

Publications (1)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

BAF45B, BRG1-associated factor 45B, NEUD4, neuro d4, SMARCG1

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICC

WB analysis using 21769-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 21769-1-AP (DPF1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 21769-1-AP
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21769-1-AP (DPF1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat brain using 21769-1-AP
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 21769-1-AP (DPF1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of MCF-7 using 21769-1-AP
Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using DPF1 antibody (21769-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DPF1 in ?

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	A431 cells, PC-3 cells, mouse cerebellum tissue
Positive IHC detected in	mouse brain tissue, rat brain tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	MCF-7 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunohistochemistry (IHC)	IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21769-1-AP targets DPF1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag16409 Product name: Recombinant human DPF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 84-193 aa of BC125153 Sequence: LNILEDPRLRPCEYKIDCEAPLKKEGGLPEGPVLEALLCAETGEKKIELKEEETIMDCQKQQLLEFPHDLEVEDLEDDIPRRKNRAKGKAYGIGGLRKRQDTASLEDRDK Predict reactive species
Full Name	D4, zinc and double PHD fingers family 1
Calculated Molecular Weight	414 aa, 47 kDa
Observed Molecular Weight	38-47 kDa
GenBank Accession Number	BC125153
Gene Symbol	DPF1
Gene ID (NCBI)	8193
RRID	AB_3085672
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q92782
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for DPF1 antibody 21769-1-AP	Download protocol
IHC protocol for DPF1 antibody 21769-1-AP	Download protocol
WB protocol for DPF1 antibody 21769-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The DPF1 Polyclonal antibody (Cat# 21769-1-AP) has 1 total citation. It was cited in Molecular Cell (IF: 16), in a 2025 study by Yuen San Chan et al. titled "β-catenin functions as a molecular adapter for disordered cBAF interactions." The research field encompasses chromatin biology and the SWI/SNF (BAF) complex, specifically investigating how β-catenin mediates interactions with the cBAF subcomplex. The antibody was used in Western blot (WB) on human samples.