Tested Applications
| Positive WB detected in | Neuro-2a cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21849-1-AP targets NRXN3 in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16293 Product name: Recombinant human NRXN3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 750-803 aa of BC152457 Sequence: STTVKDGILVRIDSAPGLGDFLQLHIEQGKIGVVFNIGTVDISIKEERTPVNDG Predict reactive species |
| Full Name | neurexin 3 |
| Calculated Molecular Weight | 1061 aa, 117 kDa |
| Observed Molecular Weight | 69 kDa |
| GenBank Accession Number | BC152457 |
| Gene Symbol | NRXN3 |
| Gene ID (NCBI) | 9369 |
| RRID | AB_2878926 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y4C0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for NRXN3 antibody 21849-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The NRXN3 Polyclonal antibody (Cat# 21849-1-AP) has 1 total citation. It appears in Cell Death Discovery (IF 10.4), published in January 2026. The cited study investigates HSP90AA1's role in restraining clear cell renal cell carcinoma progression via CADM1 expression and PI3K-AKT pathway suppression through FBXO7 interaction. The research field is oncology/cancer biology, specifically renal cell carcinoma and intracellular signaling pathways. The antibody was used for Western blot on human samples.
| Species | Application | Title |
|---|---|---|
Cell Death Discov HSP90AA1 restrains clear cell renal cell carcinoma progression by promoting CADM1 expression and suppressing the PI3K-AKT pathway through interaction with FBXO7. |
