Tested Applications
| Positive WB detected in | HeLa cells, A549 cells, mouse skin tissue, HEK-293 cells, HepG2 cells, Jurkat cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21916-1-AP targets ONECUT2 in WB, IHC, IF, IP, chIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16162 Product name: Recombinant human ONECUT2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 226-332 aa of BC108925 Sequence: PLAATPLGNGLGGLHNAQQSLPNYGPPGHDKMLSPNFDAHHTAMLTRGEQHLSRGLGTPPAAMMSHLNGLHHPGHTQSHGPVLAPSRERPPSSSSGSQVATSGQLEE Predict reactive species |
| Full Name | one cut homeobox 2 |
| Calculated Molecular Weight | 504 aa, 54 kDa |
| Observed Molecular Weight | 54-60 kDa |
| GenBank Accession Number | BC108925 |
| Gene Symbol | ONECUT2 |
| Gene ID (NCBI) | 9480 |
| RRID | AB_2848180 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95948 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ONECUT2, also named as One cut domain family member 2 or Hepatocyte nuclear factor 6-beta, is a 504 amino acid protein, which contains one CUT DNA-binding domain and one homeobox DNA-binding domain. ONECUT2 belongs to the CUT homeobox family and activates the transcription of a number of liver genes such as HNF3B. ONECUT2 is required for liver differnetiation and metabolism. ONECUT2 and ONECUT3 play redundant roles with ONECUT1 in pancreas development.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ONECUT2 antibody 21916-1-AP | Download protocol |
| IP protocol for ONECUT2 antibody 21916-1-AP | Download protocol |
| WB protocol for ONECUT2 antibody 21916-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ONECUT2 Polyclonal antibody (Cat# 21916-1-AP) has 27 citations spanning journals including Cancer Cell, Nature Medicine, Nature Cell Biology, Nature Communications, Nucleic Acids Research, Science Advances, Cell Death & Disease, PNAS, Cell Reports, and Biochemical Pharmacology. Research fields cover prostate cancer (neuroendocrine differentiation, lineage plasticity), lung adenocarcinoma, hepatocellular carcinoma, breast cancer, gastric cancer, colorectal cancer, liver regeneration, ovarian development, Parkinson's disease, osteoarthritis, and hypothermia biomarker identification.
| Species | Application | Title |
|---|---|---|
Cancer Cell Epigenomic State Transitions Characterize Tumor Progression in Mouse Lung Adenocarcinoma. | ||
Cancer Cell Temporal evolution reveals bifurcated lineages in aggressive neuroendocrine small cell prostate cancer trans-differentiation | ||
Nat Med ONECUT2 is a targetable master regulator of lethal prostate cancer that suppresses the androgen axis. | ||
Nat Cell Biol Integrated stress response couples mitochondrial fitness with lineage reprogramming to drive cancer evolution. | ||
Nat Commun Neuronal miR-9 promotes HSV-1 epigenetic silencing and latency by repressing Oct-1 and Onecut family genes |
