Tested Applications
| Positive WB detected in | Jurkat cells, HeLa cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human testis tissue, human pancreas cancer tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22441-1-AP targets LARG in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18211 Product name: Recombinant human LARG protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 214-563 aa of BC063117 Sequence: QRLLKEIQEAKKHIPQLQEQLSKATGSAQDGAVVTPSRPLGDTLTVSEAETDPGDVLGRTDCSSGDASRPSSDNADSPKSGPKERIYLEENPEKSETIQDTDTQSLVGSPSTRIAPHIIGAEDDDFGTEHEQINGQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKHTNSKETRRIFLEFHQFFLDRSAHLKVSVPDEMSADLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHLEDFRQKRSMGLTLAESELTKLDAERDKDRLTLEKERTCAEQIVAKIEEVLMTAQAVEEDKSSTMQYVILMYMKHLGVKVKEPRNLEHKRGRIGFLPKIKQSM Predict reactive species |
| Full Name | Rho guanine nucleotide exchange factor (GEF) 12 |
| Calculated Molecular Weight | 1544 aa, 173 kDa |
| Observed Molecular Weight | 220 kDa |
| GenBank Accession Number | BC063117 |
| Gene Symbol | LARG |
| Gene ID (NCBI) | 23365 |
| RRID | AB_2879107 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NZN5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LARG, also known as ARHGEF12, is one of three regulator of G protein signalling (RGS) domain-containing RhoGEFs. LARG activates the ROCK pathway downstream of Gα12/13 signaling, leading to cytoskeletal reorganisation. LARG performs this activity either as a homodimer or as a heterodimer with Arhgef11. LARG has been implicated in many diseases, including cancer, heart disease, and in HIV viral replication. LARG is phosphorylated and dephosphorylated during mitosis and that Cdk1 is the mitotic kinase responsible for LARG phosphorylation. We got 220 kDa in western blotting, maybe due to its phosphorylation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LARG antibody 22441-1-AP | Download protocol |
| IHC protocol for LARG antibody 22441-1-AP | Download protocol |
| IP protocol for LARG antibody 22441-1-AP | Download protocol |
| WB protocol for LARG antibody 22441-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The LARG Polyclonal antibody (Cat# 22441-1-AP) has 7 citations published in Cell Communications & Signaling, PNAS, British Journal of Pharmacology, International Journal of Molecular Sciences (×2), American Journal of Pathology, and Journal of Neuroscience. Research fields span reproductive cell signaling, Rho GTPase-mediated cell motility, hepatic fibrosis and portal hypertension, myogenic differentiation, cutaneous T-cell lymphoma, glioblastoma invasion, and cerebellar neurofunction.
| Species | Application | Title |
|---|---|---|
Cell Commun Signal Zinc finger DHHC-type palmitoyltransferase 13-mediated S-palmitoylation of GNA13 from Sertoli cell-derived extracellular vesicles inhibits autophagy in spermatogonial stem cells | ||
Proc Natl Acad Sci U S A RSK2 drives cell motility by serine phosphorylation of LARG and activation of Rho GTPases. | ||
Br J Pharmacol Reregulation of hepatic stellate cell contraction and cirrhotic portal hypertension by Wnt/β-catenin signaling via interaction with Gli1. | ||
Int J Mol Sci Inhibition of High-Temperature Requirement Protein A2 Protease Activity Represses Myogenic Differentiation via UPRmt | ||
Int J Mol Sci METTL3 Promotes Cutaneous T-Cell Lymphoma Progression by Regulating ARHGEF12 Expression | ||
Am J Pathol The Guanine Nucleotide Exchange Factor, Leukemia-Associated Rho Guanine Nucleotide Exchange Factor, and RhoC Play a Role in Glioblastoma Cell Invasion and Resistance.
|
Reviews
What customers say
One customer review is available for this product. Udesh Dhawan rated it 5 out of 5 stars, reporting successful use in Western Blot on MSCs at a 1:2000 dilution. The reviewer noted simply that it "worked well," indicating reliable performance under those conditions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Udesh (Verified Customer) (08-19-2024) | Worked well at 1:2000
 |
