Tested Applications
| Positive WB detected in | A549 cells, rat testis tissue, mouse ovary tissue, BxPC-3 cells, mouse liver tissue, mouse pancreas tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22460-1-AP targets NR5A2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18001 Product name: Recombinant human NR5A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 143-332 aa of BC118652 Sequence: NGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLL Predict reactive species |
| Full Name | nuclear receptor subfamily 5, group A, member 2 |
| Calculated Molecular Weight | 541 aa, 61 kDa |
| Observed Molecular Weight | 61-67 kDa |
| GenBank Accession Number | BC118652 |
| Gene Symbol | NR5A2 |
| Gene ID (NCBI) | 2494 |
| RRID | AB_2879108 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | O00482 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NR5A2 belongs to the nuclear hormone receptor family NR5 subfamily.It binds to the sequence element 5'-AACGACCGACCTTGAG-3' of the enhancer II of hepatitis B virus genes, a critical cis-element of their expression and regulation.NR5A2 may be responsible for the liver-specific activity of enhancer II, probably in combination with other hepatocyte transcription factors. Key regulator of cholesterol 7-alpha-hydroxylase gene (CYP7A) expression in liver. It may also contribute to the regulation of pancreas-specific genes and play important roles in embryonic development. LRH-1 is phosphorylated to display its normal function, including its role in the intriguing potential responses to phospholipid or other ligands. The hinge domain serine residues at 238 and 243 are required for effective phosphorylation, both in vitro and in cells (16439367).NR5A1 is abundantly expressed in pancreas, less in liver, very low levels in heart and lung. Expressed in hepG2. Isoform 1 and isoform 2 seem to be present in fetal and adult liver and hepG2 cells.The observed molecular weight of 65-70 kDa is the posphorylation of NR5A2 protein.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for NR5A2 antibody 22460-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The NR5A2 Polyclonal antibody (catalog number 22460-1-AP) has 13 total citations. These appear in journals including Cell Metabolism, Journal of Clinical Investigation, Pharmacological Research, Aging, Cell Death Discovery, Cell Proliferation, Molecular Therapy Nucleic Acids, BBA Molecular Basis of Disease, Journal of Virology, Journal of Biological Chemistry, Renal Failure, Frontiers in Oncology, and Animal Reproduction Science. Research fields span bile acid homeostasis, metabolic syndrome, pancreatic and lung cancer, renal fibrosis, diabetes-induced podocyte injury, coagulopathy, breast cancer, head and neck squamous cell carcinoma, and ovine reproduction.
| Species | Application | Title |
|---|---|---|
Cell Metab Hepatic FXR-FGF4 is required for bile acid homeostasis via an FGFR4-LRH-1 signal node under cholestatic stress | ||
J Clin Invest HSD3B1 links ileal steroid metabolism to bile acid regulation in patients with prostate cancer. | ||
Pharmacol Res Geniposide reduces cholesterol accumulation and increases its excretion by regulating the FXR-mediated liver-gut crosstalk of bile acids. | ||
Cell Death Discov NR5A2 transcriptional activation by BRD4 promotes pancreatic cancer progression by upregulating GDF15. | ||
Cell Prolif LRH-1 activation alleviates diabetes-induced podocyte injury by promoting GLS2-mediated glutaminolysis |
