Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

FOXA2 Polyclonal antibody

FOXA2 Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), IP, ELISA

Cat No. 22474-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF-P, FC (Intra), IP, CoIP, ChIP, ELISA

forkhead box A2, Forkhead box protein A2, Hepatocyte nuclear factor 3-beta, HNF 3 beta, HNF 3B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHT-29 cells, HepG2 cells, A549 cells, MDA-MB-231 cells
Positive IP detected inHepG2 cells
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat stomach tissue
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22474-1-AP targets FOXA2 in WB, IHC, IF-P, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18221

Product name: Recombinant human FOXA2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-160 aa of BC011780

Sequence: MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSGSGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAMAGMGGSAGAAGVAGMGPHLSPSLSPLGGQAAGAMGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKP

Predict reactive species
Full Name forkhead box A2
Calculated Molecular Weight 457 aa, 48 kDa
Observed Molecular Weight 55-65 kDa
GenBank Accession NumberBC011780
Gene Symbol FOXA2
Gene ID (NCBI) 3170
RRIDAB_2879110
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y261
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FOXA2 also named as HNF 3 beta or TCF3B is a 457 amino acid protein, which contains one fork-head DNA-binding domains. FOXA2 can Shuttle between the nucleus and cytoplasm in a CRM1-dependent manner. Phosphorylation on FOXA2 Thr-156 abolishes binding to target promoters and subsequent transcription activation upon INS stimulation. FOXA2 as a transcription factor involves in embryonic development, establishment of tissue-specific gene expression and regulation of gene expression in differentiated tissues. The molecular weight of FOXA2 is 48kDa, but the phosphorylated FOXA2 may be a 55-65kDa protein.

Protocols

Product Specific Protocols
FC protocol for FOXA2 antibody 22474-1-APDownload protocol
IF protocol for FOXA2 antibody 22474-1-APDownload protocol
IHC protocol for FOXA2 antibody 22474-1-APDownload protocol
IP protocol for FOXA2 antibody 22474-1-APDownload protocol
WB protocol for FOXA2 antibody 22474-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanchIP

Cell Res

Tissue-specific transcription reprogramming promotes liver metastasis of colorectal cancer.

Authors - Shuaishuai Teng
humanWB

iScience

NatD epigenetically activates FOXA2 expression to promote breast cancer progression by facilitating MMP14 expression

Authors - Mengying Xing
humanIF

Chemosphere

Comparative cytotoxicity studies of halophenolic disinfection byproducts using human extended pluripotent stem cells.

Authors - Yujie Liu
humanWB,IHC,IF

Am J Cancer Res

Epigenetically silenced linc00261 contributes to the metastasis of hepatocellular carcinoma via inducing the deficiency of FOXA2 transcription.

Authors - Zhanjun Chen
  • KD Validated
humanWB

Int J Biol Sci

EGF suppresses the expression of miR-124a in pancreatic β cell lines via ETS2 activation through the MEK and PI3K signaling pathways.

Authors - Lin Yang
mouseWB

Mol Cell Endocrinol

Mof acetyltransferase inhibition ameliorates glucose intolerance and islet dysfunction of type 2 diabetes via targeting pancreatic α-cells.

Authors - Xinghong Guo

Reviews

    5.0 out of 5
Add a review

3 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Gökçe Nihan (Verified Customer) (10-02-2025)

Immunofluorescence and Western blot applications worked beautifully with this antibody for both mouse and human samples.

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:200 IF, 1:2500 WB
  • Cell Tissue Type: hiPSC derived neuroectodermal cells and mouse primary NPCs

Kamal (Verified Customer) (07-05-2023)

Worked when diluted in TBST for WB and 1X PBS for IFC.

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:2000 (WB) and 1:200 (IFC)
  • Cell Tissue Type: Mouse Liver tissue

Kamal (Verified Customer) (07-05-2023)

Worked when diluted in TBST for WB and 1X PBS for IFC.

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:2000 (WB) and 1:200 (IFC)
  • Cell Tissue Type: Mouse Liver tissue
Loading...
||
New chat

Able

正在加载,请稍候...