Tested Applications
| Positive WB detected in | mouse testis tissue, rat testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
23172-1-AP targets ERVWE1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19227 Product name: Recombinant human ERVWE1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 274-371 aa of BC137381 Sequence: TSAYRCLNGSSESMCFLSFLVPPMTIYTEQDLYSYVISKPRNKRVPILPFVIGAGVLGALGTGIGGITTSTQFYYKLSQELNGDMERVADSLVTLQDQ Predict reactive species |
| Full Name | endogenous retroviral family W, env(C7), member 1 |
| Calculated Molecular Weight | 538 aa, 60 kDa |
| Observed Molecular Weight | 70-73 kDa |
| GenBank Accession Number | BC137381 |
| Gene Symbol | ERVWE1 |
| Gene ID (NCBI) | 30816 |
| RRID | AB_3085707 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UQF0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ERVWE1 encodes a 538 amino-acid, 73-kDa glycosylated (60 kDa unglycosylated) envelope protein, Syncytin-1. It is expressed in the placental syncytiotrophoblast and participates in syncytium formation during placenta morphogenesis. Mounting evidence suggests that aberrant expression of ERVWE1 involves the etiology of schizophrenia.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ERVWE1 antibody 23172-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ERVWE1 (Syncytin-1) polyclonal antibody (Cat# 23172-1-AP) has 2 citations. These appear in Advanced Science (IF 14.1) and Cell Signaling (IF 4.7). Both studies used the antibody for Western blot in human samples. The research fields encompass endoplasmic reticulum stress and glycoprotein quality control in gestational diabetes mellitus, as well as trophoblast fusion, invasion, and pre-eclampsia pathogenesis.
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Malectin Alleviates Endoplasmic Reticulum Stress in Gestational Diabetes Mellitus via Glycoprotein Quality Control Mechanisms. | ||
Cell Signal Potential role of Hematopoietic PBX-Interacting Protein (HPIP) in trophoblast fusion and invasion: Implications in pre-eclampsia pathogenesis |
