Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
23854-1-AP targets BCHE in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20888 Product name: Recombinant human BCHE protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 539-602 aa of BC008396 Sequence: MTKLRAQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCVGL Predict reactive species |
| Full Name | butyrylcholinesterase |
| Calculated Molecular Weight | 602 aa, 68 kDa |
| Observed Molecular Weight | 85-90 kDa |
| GenBank Accession Number | BC008396 |
| Gene Symbol | BCHE |
| Gene ID (NCBI) | 590 |
| RRID | AB_2879341 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | P06276 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BCHE(butyrylcholinesterase) is an enzyme expressed in most human tissues. It may have a greater role in cholinergic transmission than previously surmised, making BChE inhibition an important therapeutic goal in Alzheimer's disease(PMID:11848688). BCHE is also named as CHE1 and belongs to the type-B carboxylesterase/lipase family. This is a glycoprotein with the molecular weight from 68 kDa to 90 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for BCHE antibody 23854-1-AP | Download protocol |
| IHC protocol for BCHE antibody 23854-1-AP | Download protocol |
| WB protocol for BCHE antibody 23854-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-BCHE antibody (Cat# 23854-1-AP) has 4 total citations published in Nature Biomedical Engineering, Frontiers in Immunology, Cells, and Turkish Journal of Biology. Research fields span cocaine addiction and epigenetics, gastric cancer lipid metabolism and immune infiltration, CRISPR/Cas9-mediated transgenic goat generation, and prostate cancer taxane resistance. Applications include WB, IHC, and IF in human and goat samples.
| Species | Application | Title |
|---|---|---|
Nat Biomed Eng Genome-edited skin epidermal stem cells protect mice from cocaine-seeking behaviour and cocaine overdose. | ||
Front Immunol Progressions of the correlation between lipid metabolism and immune infiltration characteristics in gastric cancer and identification of BCHE as a potential biomarker | ||
Cells Improving the Efficiency of Precise Genome Editing with CRISPR/Cas9 to Generate Goats Overexpressing Human Butyrylcholinesterase | ||
Turk J Biol Butyrylcholinesterase (BChE) downregulation in taxane resistance: implications for prostate cancer |
