Tested Applications
| Positive WB detected in | Jurkat cells, mouse colon tissue, rat colon tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
23912-1-AP targets TMEM150 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21019 Product name: Recombinant human TMEM150 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 222-271 aa of BC050466 Sequence: YGTFSYEFGAVSSDTLVAALQPTPGRACKSSGSSSTSTHLNCAPESIAMI Predict reactive species |
| Full Name | transmembrane protein 150 |
| Calculated Molecular Weight | 271 aa, 29 kDa |
| Observed Molecular Weight | 33 kDa |
| GenBank Accession Number | BC050466 |
| Gene Symbol | TMEM150 |
| Gene ID (NCBI) | 129303 |
| RRID | AB_3669424 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | Q86TG1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Transmembrane protein 150 (TMEM150) mediates plasma membrane targeting of PI4K, likely by weakening the interaction between TTC7 and PI4K complex. It modulates PtdIns4P synthesis and is implicated in fasting-triggered catabolism (PMID: 25608530; 24360784).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for TMEM150 antibody 23912-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

