Tested Applications
| Positive WB detected in | A549 cells |
| Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24604-1-AP targets GALNT13 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16526 Product name: Recombinant human GALNT13 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 499-561 aa of BC101032 Sequence: MRGNQLWEYDAESCLSVNKVADGSQHPTVETCNDSTLQKWLLRNYTRMEIFRNIFGNSTDYIL Predict reactive species |
| Full Name | UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 (GalNAc-T13) |
| Calculated Molecular Weight | 561 aa, 65 kDa |
| Observed Molecular Weight | 64 kDa |
| GenBank Accession Number | BC101032 |
| Gene Symbol | GALNT13 |
| Gene ID (NCBI) | 114805 |
| RRID | AB_3742118 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8IUC8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Polypeptide N-acetylgalactosaminyltransferase 13 (GALNT13) is a recently identified member of the UDP-N-acetylgalactosamine: polypeptide N-acetyl galactosaminy transferases family, otherwise known as ppGalNAc-Tases, which control the initiation of mucin-type O-glycosylation. GALNT13 and the trimeric Tn antigen have been considered as tumor-associated antigens, and might be useful prognostic factors in many types of human cancers (PMID: 34830771, 27499036, 36575396)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for GALNT13 antibody 24604-1-AP | Download protocol |
| IHC protocol for GALNT13 antibody 24604-1-AP | Download protocol |
| WB protocol for GALNT13 antibody 24604-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
What customers say
The single review for this product reports a 5-star rating for its use in immunohistochemistry on human cancer tissue. The reviewer noted that the antibody "works well for IHC," indicating satisfactory performance in their application. Overall, the feedback is positive, with no issues or concerns raised regarding specificity, staining quality, or reliability.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Jennifer (Verified Customer) (04-24-2026) | Works well for IHC
|
