Tested Applications
| Positive WB detected in | C6 cells, PC-3 cells, mouse embryo |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24903-1-AP targets SOX17 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19157 Product name: Recombinant human SOX17 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-66 aa of BC111365 Sequence: MSSPDAGYASDDQSQTQSALPAVMAGLGPCPWAESLSPIGDMKVKGEAPANSGAPAGAAGRAKGES Predict reactive species |
| Full Name | SRY (sex determining region Y)-box 17 |
| Calculated Molecular Weight | 414 aa, 44 kDa |
| Observed Molecular Weight | 44 kDa |
| GenBank Accession Number | BC111365 |
| Gene Symbol | SOX17 |
| Gene ID (NCBI) | 64321 |
| RRID | AB_2879789 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H6I2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Transcription factor SOX 17 (SOX17) also named as SRY box 17 is a 414 amino acid protein, which contains one Sox C-terminal domain and one HMG box DNA-binding domain. SOX17 as a transcription regulator binds target promoter DNA and bend the DNA via WNT3A. SOX17 is a marker of endodermal cells and a transcriptional regulator containing a DNA binding domain called the HMG box. In mouse embryos, SOX17 plays critical roles in the growth and differentiation of definitive endodermal cells (PMID: 11973269), the remodeling of endothelial cells (PMID: 16895970), hindgut endoderm expansion with localization of primordial germ cells (PMID: 19371732), and gallbladder/bile duct formation (PMID: 19913509).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SOX17 antibody 24903-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SOX17 Polyclonal antibody (Cat# 24903-1-AP) has 29 citations. These appear in journals including Cell Stem Cell, Am J Respir Crit Care Med, Small, Mater Today Bio, Cell Mol Life Sci, EMBO Rep, Stem Cell Reports, Front Cell Dev Biol, Cell Signal, J Neurochem, Anal Bioanal Chem, Hum Cell, PLoS One, and Stem Cell Res. Research fields span stem cell biology and iPSC line generation, pluripotency, endodermal differentiation, brain evolution, pulmonary hypertension, angiogenesis, wound healing, and various disease models (cardiomyopathy, neurodegeneration, metabolic disorders).
| Species | Application | Title |
|---|---|---|
Cell Stem Cell Molecular signature of primate astrocytes reveals pathways and regulatory changes contributing to human brain evolution | ||
Am J Respir Crit Care Med SOX17 Deficiency Mediates Pulmonary Hypertension: At the Crossroads of Sex, Metabolism, and Genetics
| ||
Small Microperfused Biomimetic Liver-on-a-Chip for High-Throughput Hepatotoxicity Screening. | ||
Mater Today Bio Nanofiber-microwell cell culture system for spatially patterned differentiation of pluripotent stem cells in 3D | ||
Cell Mol Life Sci Deubiquitinase UCHL1 promotes angiogenesis and blood-spinal cord barrier function recovery after spinal cord injury by stabilizing Sox17 | ||
EMBO Rep Glycolytic Pfkp acts as a Lin41 protein kinase to promote endodermal differentiation of embryonic stem cells |
Reviews
What customers say
The single review for this product is a 5-star rating for Western Blot. The user reported a clear band using a 1:4000 dilution with overnight incubation on mESCs. Overall, the feedback is positive, indicating the antibody performs well under standard WB conditions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Claudia (Verified Customer) (03-06-2026) | clear band at 1:4000 overnight incubation
|
