Tested Applications
| Positive WB detected in | human testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24986-1-AP targets AKAP4 in WB, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21762 Product name: Recombinant human AKAP4 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 565-693 aa of BC126252 Sequence: TCEEDCPGSTMGYMAQSTQYEKCGGGQSAKALSVKQLESHRAPGPSTCQKENQHLDSQKMDMSNIVLMLIQKLLNENPFKCEDPCEGENKCSEPRASKAASMSNRSDKAEEQCQEHQELDCTSGMKQAN Predict reactive species |
| Full Name | A kinase (PRKA) anchor protein 4 |
| Calculated Molecular Weight | 854 aa, 94 kDa |
| Observed Molecular Weight | 82 kDa |
| GenBank Accession Number | BC126252 |
| Gene Symbol | AKAP4 |
| Gene ID (NCBI) | 8852 |
| RRID | AB_2876859 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q5JQC9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
AKAP4, also named as A-kinase anchor protein 82 kDa, is a 854 amino acid protein, which belongs to the AKAP110 family. AKAP4 localizes to the principle piece of the sperm flagellum and is only expressed in round spermatids. AKAP4 is a major structural component of sperm fibrous sheath and plays a role in sperm motility.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for AKAP4 antibody 24986-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The AKAP4 Polyclonal antibody (Cat# 24986-1-AP) has 11 total citations. These appear in journals including Science China Life Sciences, PNAS, Journal of Animal Science and Biotechnology, Frontiers in Endocrinology, Frontiers in Cell and Developmental Biology, Animals, Life Science Alliance, Asian Journal of Andrology, Translational Andrology and Urology, and Andrologia. The research fields span reproductive biology and male infertility (sperm flagella abnormalities, asthenozoospermia), proteomics/phosphoproteomics, cancer (breast cancer/HER2), and cell biology (flagellar axoneme energetics). Applications were mainly WB and IF.
| Species | Application | Title |
|---|---|---|
Sci China Life Sci Adenylate kinase phosphate energy shuttle underlies energetic communication in flagellar axonemes | ||
Proc Natl Acad Sci U S A FSIP1 binds HER2 directly to regulate breast cancer growth and invasiveness. | ||
J Anim Sci Biotechnol Dissecting the development of bovine testicular tissue using spatial transcriptomics. | ||
Front Endocrinol (Lausanne) Alterations in the protein lactylation landscape of sperm from patients with varicocele-associated asthenozoospermia. | ||
Front Cell Dev Biol Comparative Proteomics and Phosphoproteomics Analysis Reveal the Possible Breed Difference in Yorkshire and Duroc Boar Spermatozoa. | ||
