Tested Applications
| Positive IHC detected in | human lung cancer tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25101-1-AP targets WFDC12 in WB, IF, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18795 Product name: Recombinant human WFDC12 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 34-111 aa of BC146514 Sequence: CPADNVRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKCPGSSSTRCPQK Predict reactive species |
| Full Name | WAP four-disulfide core domain 12 |
| Calculated Molecular Weight | 111 aa, 12 kDa |
| GenBank Accession Number | BC146514 |
| Gene Symbol | WFDC12 |
| Gene ID (NCBI) | 128488 |
| RRID | AB_2879897 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8WWY7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for WFDC12 antibody 25101-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-WFDC12 (Cat# 25101-1-AP) has 3 total citations published in Cell Death & Disease, Frontiers in Immunology, and Journal of Investigative Dermatology. The research fields span atopic dermatitis pathogenesis, psoriasis development, and epidermal keratinocyte differentiation with regulation of serine protease activity. Applications used include IHC, IF, and WB in human samples.
| Species | Application | Title |
|---|---|---|
Cell Death Dis WFDC12-overexpressing contributes to the development of atopic dermatitis via accelerating ALOX12/15 metabolism and PAF accumulation | ||
J Invest Dermatol The Whey Acidic Protein WFDC12 Is Specifically Expressed in Terminally Differentiated Keratinocytes and Regulates Epidermal Serine Protease Activity.
| ||
Front Immunol A role for whey acidic protein four-disulfide-core 12 (WFDC12) in the pathogenesis and development of psoriasis disease |
