Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue, Transfected HEK-293 cells |
| Positive IHC detected in | mouse heart tissue, human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25206-1-AP targets DAAM2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18955 Product name: Recombinant human DAAM2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 4-55 aa of BC128388 Sequence: RKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAEL Predict reactive species |
| Full Name | dishevelled associated activator of morphogenesis 2 |
| Calculated Molecular Weight | 1068 aa, 123 kDa |
| Observed Molecular Weight | 100-130 kDa |
| GenBank Accession Number | BC128388 |
| Gene Symbol | DAAM2 |
| Gene ID (NCBI) | 23500 |
| RRID | AB_2879959 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q86T65 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DAAM2 antibody 25206-1-AP | Download protocol |
| IHC protocol for DAAM2 antibody 25206-1-AP | Download protocol |
| WB protocol for DAAM2 antibody 25206-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The DAAM2 Polyclonal antibody (catalog number 25206-1-AP) has 5 total citations. These appear in Advanced Healthcare Materials, Frontiers in Molecular Biosciences, Clinical Immunology, Clinical and Translational Oncology, and Journal of Ethnopharmacology. The research fields span osteogenesis and Wnt10b signaling, pancreatic adenocarcinoma immunophenotyping, PD-L1 expression and immunotherapy response, cancer prognosis (glioma, liver, breast), and chronic kidney disease–related renal and bone injury involving Wnt5a/RhoA/Pkn3 signaling. Applications cited include WB, IHC, and IF.
| Species | Application | Title |
|---|---|---|
Adv Healthc Mater A Highly Bioactive Organic-Inorganic Nanoparticle for Activating Wnt10b Mediated Osteogenesis by Specifically Anchor CCN3 Protein | ||
Front Mol Biosci Dishevelled-Associated Activator of Morphogenesis 2 (DAAM2) Predicts the Immuno-Hot Phenotype in Pancreatic Adenocarcinoma. | ||
Clin Immunol Formin protein DIAPH1 positively regulates PD-L1 expression and predicts the therapeutic response to anti-PD-1/PD-L1 immunotherapy | ||
Clin Transl Oncol The prognostic value of DAAM2 in lower grade glioma, liver cancer, and breast cancer
| ||
J Ethnopharmacol Shenqi Yanshen Decoction protects against renal and bone injury in chronic kidney disease-mineral and bone disorder with potential involvement of Wnt5a/RhoA/Pkn3 signaling. |
Reviews
What customers say
The single review for this product is a 5-star rating. The reviewer used the antibody for Western Blot at a 1:1000 dilution on U2OS osteosarcoma cells and reported that it was successfully verified in an siRNA-mediated knockdown experiment. Overall, the feedback is positive, confirming the antibody's performance and specificity in knockdown validation.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Erithelgi (Verified Customer) (11-11-2019) | The antibody was verified in an siRNA mediated knockdown
|
