Tested Applications
| Positive WB detected in | Jurkat cells, Raji cells, mouse spleen tissue, rat spleen tissue |
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25300-1-AP targets ASB14 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18147 Product name: Recombinant human ASB14 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 366-478 aa of BC114953 Sequence: SNSDLSSVKLLLSAGALPNQDPVNCLQIALRMGNYELISLLLRHGANVNYFCRVNPLHFPSALQYTLKDEVMLRMLLNYGYDTERCFDCPHGDKVHPSYTVEGWTSTVIKDTK Predict reactive species |
| Full Name | ankyrin repeat and SOCS box-containing 14 |
| Calculated Molecular Weight | 587 aa, 65 kDa |
| Observed Molecular Weight | 65 kDa |
| GenBank Accession Number | BC114953 |
| Gene Symbol | ASB14 |
| Gene ID (NCBI) | 142686 |
| RRID | AB_2880017 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | A6NK59 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ASB14 antibody 25300-1-AP | Download protocol |
| WB protocol for ASB14 antibody 25300-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ASB14 antibody (catalog #25300-1-AP) has 1 total citation, published in FASEB Journal (2025). The associated research field is mitochondrial biology and cardiology, specifically integrating multiomics approaches to reveal and validate key proteins, metabolites, and pathways of ASB14 affecting mitochondrial function in human cardiomyocytes (AC16 cells). The antibody was applied in Western Blot.
| Species | Application | Title |
|---|---|---|
FASEB J Integrating Multiomics to Reveal and Validate Key Proteins, Metabolites, and Pathways of ASB14 Affecting Mitochondrial Function in Cardiomyocytes AC16 |
