Tested Applications
| Positive WB detected in | HepG2 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25556-1-AP targets ZNF695 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22202 Product name: Recombinant human ZNF695 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 88-133 aa of BC023527 Sequence: LSSYLTEDILPEQGLQVSFQKVMLRRYERCCLEKLRLRNDWEIVAM Predict reactive species |
| Full Name | zinc finger protein 695 |
| Calculated Molecular Weight | 515 aa, 60 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC023527 |
| Gene Symbol | ZNF695 |
| Gene ID (NCBI) | 57116 |
| RRID | AB_2880130 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8IW36 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Oncol Rep Zinc finger protein 695 facilitates the proliferation of colorectal cancer cells through activation of the NEK2 and PI3K/Akt/mTOR signaling pathways
| ||
J Cancer Five-gene signature associating with Gleason score serve as novel biomarkers for identifying early recurring events and contributing to early diagnosis for Prostate Adenocarcinoma. |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Claire (Verified Customer) (01-13-2026) | This antibody did not detect ZNF695 by western blot in three different cell types - hBJ fibroblasts, MCF7, and HEPG2. Please see attached files for details.
![]() |






