VNN2 Polyclonal antibody

VNN2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 25643-1-AP

Publications (2)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

FOAP 4, GPI 80, Protein FOAP 4, vanin 2, VNN2

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIF/ICC

WB analysis of HeLa using 25643-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 25643-1-AP (VNN2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HeLa using 25643-1-AP
Immunofluorescent analysis of HeLa cells using 25643-1-AP (VNN2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for VNN2 in ?

Overview

Tested Applications
Product Information
Publications (2)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HeLa cells
Positive IF/ICC detected in	HeLa cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunofluorescence (IF)/ICC	IF/ICC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25643-1-AP targets VNN2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag22345 Product name: Recombinant human VNN2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 448-520 aa of BC126145 Sequence: EIHLSPGKFEVLKDGRLVNKNGSSGPILTVSLFGRWYTKDSLYSSCGTSNSAITYLLIFILLMIIALQNIVML Predict reactive species
Full Name	vanin 2
Calculated Molecular Weight	520 aa, 59 kDa
Observed Molecular Weight	33 kDa
GenBank Accession Number	BC126145
Gene Symbol	VNN2
Gene ID (NCBI)	8875
RRID	AB_2880173
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O95498
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for VNN2 antibody 25643-1-AP	Download protocol
WB protocol for VNN2 antibody 25643-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The VNN2 Polyclonal antibody (Cat# 25643-1-AP) has 2 citations. These appear in Journal of the European Academy of Dermatology and Venereology and Oncology Reports. The cited research spans dermatology (proteomic analysis of verrucous epidermal naevi in children) and oncology (microRNA regulation of osteosarcoma cell proliferation and invasion via VNN2 targeting).

Species	Application	Title
Human	WB	J Eur Acad Dermatol Venereol Differentially expressed proteins identified by TMT proteomics analysis in children with verrucous epidermal naevi. Authors - T Yuan View Article
		Oncol Rep MicroRNA‑106a regulates the proliferation and invasion of human osteosarcoma cells by targeting VNN2. Authors - Yao Chen View Article