Tested Applications
| Positive WB detected in | mouse cerebellum tissue, rat cerebellum tissue |
| Positive IHC detected in | human cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25779-1-AP targets GRIK1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22664 Product name: Recombinant human GRIK1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 837-905 aa of BC156975 Sequence: VAIGEFIYKSRKNNDIEQCLSFNAIMEELGISLKNQKKIKKKSRTKGKSSFTSILTCHQRRTQRKETVA Predict reactive species |
| Full Name | glutamate receptor, ionotropic, kainate 1 |
| Calculated Molecular Weight | 918 aa, 104 kDa |
| Observed Molecular Weight | 95-100 kDa |
| GenBank Accession Number | BC156975 |
| Gene Symbol | GRIK1 |
| Gene ID (NCBI) | 2897 |
| RRID | AB_2880236 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P39086 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GRIK1 antibody 25779-1-AP | Download protocol |
| WB protocol for GRIK1 antibody 25779-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The GRIK1 Polyclonal antibody (Cat# 25779-1-AP) has 3 citations. These appear in Biological Sex Differences, Oncology Research, and Experimental and Therapeutic Medicine. The research fields span Alzheimer's disease (hippocampal spatial proteomics in mice), glioblastoma malignancy, and colorectal carcinoma, where GRIK1 was identified as a tumor suppressor. Applications cited include WB and IHC in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Biol Sex Differ Mapping the hippocampal spatial proteomic signature in male and female mice of an early Alzheimer's disease model | ||
Oncol Res GRIK1 promotes glioblastoma malignancy and is a novel prognostic factor of poor prognosis | ||
Exp Ther Med Glutamate receptor ionotropic, kainate 1 serves as a novel tumor suppressor of colorectal carcinoma and predicts clinical prognosis. |
