Tested Applications
| Positive IHC detected in | mouse testis tissue, rat testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25913-1-AP targets TRIM36 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23240 Product name: Recombinant human TRIM36 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 166-215 aa of BC130334 Sequence: ESTKSCMDCSASYCNECFKIHHPWGTIKAQHEYVGPTTNFRPKILMCPEH Predict reactive species |
| Full Name | tripartite motif-containing 36 |
| Observed Molecular Weight | 83 kDa |
| GenBank Accession Number | BC130334 |
| Gene Symbol | TRIM36 |
| Gene ID (NCBI) | 55521 |
| RRID | AB_2880293 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NQ86 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TRIM36, a member of the tripartite motif (TRIM) family of RING-containing proteins, also known as Haprin, is a microtubule-associated E3 ubiquitin ligase that plays a role in cytoskeletal organization, which was first discovered for its abundance in testis and found to be implicated in the spermatozoa acrosome reaction (PMID: 35053362, 30944633). TRIM36 was reported as a novel androgen signaling target gene and is upregulated in prostate cancer (PMID: 29449534).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TRIM36 antibody 25913-1-AP | Download protocol |
| IHC protocol for TRIM36 antibody 25913-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TRIM36 Polyclonal antibody (Cat# 25913-1-AP) has 1 total citation. It appears in Cell Biology and Toxicology (2026), where it was used in Western blot to study how the E3 ubiquitin ligase TRIM36 targets DDX3X for degradation to reprogram macrophage polarization and ameliorate tubal factor infertility in rats. The associated research fields include ubiquitination, macrophage biology, and reproductive medicine.
| Species | Application | Title |
|---|---|---|
Cell Biol Toxicol E3 ubiquitin ligase trim36 targets ddx3x for degradation to reprogram macrophage polarization and ameliorate tubal factor infertility in rats. |
