Tested Applications
| Positive IP detected in | COLO 320 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25992-1-AP targets ZNF580 in WB, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23313 Product name: Recombinant human ZNF580 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-124 aa of BC017698 Sequence: MLLLPPRPPHPRSSSPEAMDPPPPKAPPFPKAEGPSSTPSSAAGPRPPRLGRHLLIDANGVPYTYTVQLEEEPRGPPQREAPPGEPGPRKGYSCPECARVFASPLRLQSHRVSHSDLKPFTCGA Predict reactive species |
| Full Name | zinc finger protein 580 |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | BC017698 |
| Gene Symbol | ZNF580 |
| Gene ID (NCBI) | 51157 |
| RRID | AB_3669515 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UK33 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ZNF580 enables sequence-specific double-stranded DNA binding activity. Involved in several processes, including cellular response to hydrogen peroxide; positive regulation of cell migration; and positive regulation of interleukin-8 production.
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for ZNF580 antibody 25992-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ZNF580 Polyclonal antibody (Cat# 25992-1-AP) has 1 citation to date. The citation appears in ACS Omega (2025), a study investigating the role of Zinc Finger Protein 580 in ischemia-reperfusion injury through bioinformatics and experimental verification. The antibody was used in Western Blot (WB) on human samples. The associated research field encompasses cardiac injury, bioinformatics, and zinc finger protein biology.
| Species | Application | Title |
|---|---|---|
ACS Omega Identification and Analysis of the Role of Zinc Finger Protein 580 in Ischemeia-Reperfusion Injury through Bioinformatics and Experimental Verification |
