Featured Product
KD/KO Validated

BOLA2 Polyclonal antibody

BOLA2 Polyclonal Antibody for WB, ELISA

Cat No. 26080-1-AP

Publications (1)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

BOLA2A, BOLA2B, BolA-like protein 2, My016

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWB

WB analysis of HepG2 using 26080-1-AP
HepG2 cells were subjected to SDS PAGE followed by western blot with 26080-1-AP (BOLA2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human testis using 26080-1-AP
human testis tissue were subjected to SDS PAGE followed by western blot with 26080-1-AP (BOLA2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for BOLA2 in ?

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in

HepG2 cells, human testis tissue

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26080-1-AP targets BOLA2 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag23260 Product name: Recombinant human BOLA2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-104 aa of BC130403 Sequence: MASAKSLDRWKARLLEGGSTALTYALVRAEVSFPAEVAPVRQQGSVAGARAGVVSLLGCRSSWTAAMELSAEYLREKLQRDLEAEHVEVEDTTLNRCSCSFRVL Predict reactive species
Full Name	bolA homolog 2 (E. coli)
Observed Molecular Weight	7 kDa
GenBank Accession Number	BC130403
Gene Symbol	BOLA2
Gene ID (NCBI)	552900
RRID	AB_2880367
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9H3K6
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
WB protocol for BOLA2 antibody 26080-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The BOLA2B antibody (catalog number 26080-1-AP) has 1 total citation. This citation appears in Frontiers in Genetics (2023), a study titled "Integrative analysis of the role of BOLA2B in human pan-cancer." The research field is cancer biology, specifically pan-cancer analysis. The antibody was used in Western blot (WB) applications on human samples, with RNAi validation.