Tested Applications
| Positive WB detected in | BGC-823 cells, NCI-H1299 cells, Raji cells, SH-SY5Y cells |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26590-1-AP targets KCC4/SLC12A7 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24954 Product name: Recombinant human SLC12A7 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 953-1004 aa of BC098390 Sequence: IHDRNTASHTAAAARTQAPPTPDKVQMTWTREKLIAEKYRSRDTSLSGFKDL Predict reactive species |
| Full Name | solute carrier family 12 (potassium/chloride transporters), member 7 |
| Observed Molecular Weight | 119 kDa |
| GenBank Accession Number | BC098390 |
| Gene Symbol | KCC4/SLC12A7 |
| Gene ID (NCBI) | 10723 |
| RRID | AB_2918103 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y666 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
KCC4, also named as Solute carrier family 12 member 7(SLC12A7), is a 1083 amino-acid protein, which belongs to the SLC12A transporter family. As a multi-pass membrane protein, the molecular weight of KCC4 is 119 kDa. KCC4 mediates electroneutral potassium-chloride cotransport when activated by cell swelling. Moreover, KCC4 may mediate K+ uptake into Deiters' cells in the cochlea and contribute to K+ recycling in the inner ear. KCC4 is important for the survival of cochlear outer and inner hair cells and the maintenance of the organ of Corti(Uniprot, GeneID:10723).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for KCC4/SLC12A7 antibody 26590-1-AP | Download protocol |
| WB protocol for KCC4/SLC12A7 antibody 26590-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Bishwa Ranjan (Verified Customer) (08-03-2023) | In the Western blots there is an additional band below at 98kD which seems like a degradation or non-specific binding of the antibody. The bands showing at 120-130kD are accurate as we have seen in the lanes from knockdowns and overexpression of protein KCC4 For reference information about the lanes: 1. MDA KCC4 overexpression 2. MDA KCC4 knockdown sequence1 3. MDA KCC4 knockdown sequence2 4. MDA KCC4 knockdown sequence3 5. MDA scrambled control As you can see in lane 5 which is the control has expression of kCC4 at 120-130 range and for the knockdowns there is a decrease more significantly for 2nd sequence and for overexpression in lane 1 it is quite high so we believe the top band is the expected one and the bottom one is a result of degradation maybe so please advice on this matter. As for the antibody we received it in April 2023 and it is stored at -20 as mentioned.
 |
