Tested Applications
| Positive WB detected in | Caco-2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26687-1-AP targets BTN1A1 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24613 Product name: Recombinant human BTN1A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 448-526 aa of BC096312 Sequence: SNVTFSGPLRPFFCLWSSGKKPLTICPIADGPERVTVIANAQDLSKEIPLSPMGEDSAPRDADTLHSKLIPTQPSQGAP Predict reactive species |
| Full Name | butyrophilin, subfamily 1, member A1 |
| Calculated Molecular Weight | 526 aa, 59 kDa |
| Observed Molecular Weight | 65-75 kDa |
| GenBank Accession Number | BC096312 |
| Gene Symbol | BTN1A1 |
| Gene ID (NCBI) | 696 |
| RRID | AB_2880603 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13410 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BTN1A1, also named as Butyrophilin subfamily 1 member A1, is a 526 amino acid protein, which contains 1 B30.2/SPRY domain and belongs to the immunoglobulin superfamily. BTN/MOG family. BTN1A1 localizes in the integral component of plasma membrane. BTN1A1 may function in the secretion of milk-fat droplets and may act as a specific membrane-associated receptor for the association of cytoplasmic droplets with the apical plasma membrane. BTN1A1 Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion. The calculated molecular weight of BTN1A1 is a 59 kDa, but the modified BTN1A1 protein is about 65-75 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for BTN1A1 antibody 26687-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The BTN1A1 Polyclonal antibody (Cat# 26687-1-AP) has 1 citation. It was used in a Western blot study published in Biochemical and Biophysical Research Communications (2024), which focused on simple methods for measuring milk exosomes using fluorescent compounds. The research field is exosome biology and biochemistry, with the antibody applied to mouse samples.
| Species | Application | Title |
|---|---|---|
Biochem Biophys Res Commun Simple methods for measuring milk exosomes using fluorescent compound GIF-2250/2276 |
