Tested Applications
| Positive WB detected in | BxPC-3 cells, ROS1728 cells, HCT 116 cells |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26984-1-AP targets Collagen Type X in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, rabbit |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25741 Product name: Recombinant human COL10A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 518-585 aa of BC130621 Sequence: QAVMPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPR Predict reactive species |
| Full Name | collagen, type X, alpha 1 |
| Calculated Molecular Weight | 680 aa, 66 kDa |
| Observed Molecular Weight | 60-66 kDa |
| GenBank Accession Number | BC130621 |
| Gene Symbol | COL10A1 |
| Gene ID (NCBI) | 1300 |
| RRID | AB_3085918 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q03692 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Collagen type X alpha 1 (COL10A1), a secreted, short-chain collagen, belongs to the collagen family, which is a major interstitial matrix component specifically expressed by hypertrophic chondrocytes. COL10A1 expression is elevated in many solid tumor types, such as colon cancer, esophagus cancer, and breast cancer, and displays vital roles in many critical cellular processes (PMID: 30154451, 25321476).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Collagen Type X antibody 26984-1-AP | Download protocol |
| WB protocol for Collagen Type X antibody 26984-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
26984-1-AP (anti-COL10A1) has 27 citations in journals including Advanced Materials, Bioactive Materials, Biomaterials, Oncogene, Stem Cell Research & Therapy, Human Molecular Genetics, and Cellular and Molecular Life Sciences. Research fields span bone/cartilage regeneration, osteoarthritis, chondrogenic differentiation, growth plate development, osteonecrosis, and ferroptosis.
| Species | Application | Title |
|---|---|---|
Adv Mater Biodegradable Self-Enhancing Piezoelectric Scaffold for Synchronized Tendon-to-Bone Regeneration. | ||
Bioact Mater Bioinspired scaffold recapitulating chondrogenic ontogeny and microenvironment for functional cartilage regeneration. | ||
Bioact Mater Immune-modulated adhesive hydrogel for enhancing osteochondral graft adhesion and cartilage repair | ||
Adv Sci (Weinh) PIEZO1-GPX4 Axis Mediates Mechanical Stress-Induced Vertebral Growth Plate Dysplasia via Ferroptosis Activation | ||
Biomaterials Dual-loaded BMSCs-Metformin microgels promote cartilage repair through combined anti-inflammatory, antioxidant, and regenerative effects. | ||
Int J Biol Sci Mettl1-mediated m7G modification of Fgfr2 regulates osteogenic and chondrogenic differentiation of mesenchymal stem cells |
Reviews
What customers say
The product has one review from Audrey Burban (July 2026), who rated it 5 stars. She used it at a 1/200 dilution for immunofluorescence and commented that it "works well." Overall, the limited feedback is positive, with the sole reviewer reporting satisfactory performance in IF applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Audrey (Verified Customer) (07-02-2026) | works well
|
